Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XMN7

Protein Details
Accession A0A0J0XMN7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-130MAAKVEKPSRKLRKERKNRAKKFRGVKKVGASABasic
NLS Segment(s)
PositionSequence
97-133GMAAKVEKPSRKLRKERKNRAKKFRGVKKVGASAAKK
Subcellular Location(s) mito 21, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MDPNGPVTLRTSKFITNRLLQRKQFVVTVTHPTRANLSRDEVAERLAQLYKADKERVVVFGLRTKFGGGVTVGFGLVYDDEDAQRKFEPRFRLVRNGMAAKVEKPSRKLRKERKNRAKKFRGVKKVGASAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.44
4 0.51
5 0.58
6 0.64
7 0.6
8 0.62
9 0.59
10 0.55
11 0.49
12 0.41
13 0.36
14 0.31
15 0.38
16 0.35
17 0.36
18 0.34
19 0.32
20 0.36
21 0.35
22 0.35
23 0.27
24 0.29
25 0.27
26 0.28
27 0.29
28 0.24
29 0.22
30 0.19
31 0.17
32 0.14
33 0.13
34 0.12
35 0.1
36 0.13
37 0.15
38 0.17
39 0.18
40 0.17
41 0.18
42 0.19
43 0.2
44 0.18
45 0.16
46 0.13
47 0.17
48 0.18
49 0.17
50 0.16
51 0.14
52 0.13
53 0.12
54 0.12
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.08
69 0.08
70 0.09
71 0.11
72 0.13
73 0.15
74 0.2
75 0.26
76 0.29
77 0.37
78 0.4
79 0.48
80 0.48
81 0.51
82 0.51
83 0.47
84 0.42
85 0.37
86 0.35
87 0.27
88 0.31
89 0.31
90 0.3
91 0.32
92 0.42
93 0.5
94 0.58
95 0.68
96 0.73
97 0.78
98 0.86
99 0.92
100 0.93
101 0.94
102 0.95
103 0.95
104 0.94
105 0.93
106 0.92
107 0.91
108 0.91
109 0.87
110 0.84
111 0.81
112 0.78
113 0.74