Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WAF8

Protein Details
Accession B2WAF8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-84GNAAVIRKSRHKRPILPREKFREAGHydrophilic
NLS Segment(s)
PositionSequence
66-80RKSRHKRPILPREKF
Subcellular Location(s) mito 10, extr 7, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MHLQSLIVLLAAVGACHAAPAEKCSQGTQSTGPCLFPEVLRECSSYAPVGVCHGYTKANGNAAVIRKSRHKRPILPREKFREAGHLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.09
8 0.13
9 0.15
10 0.15
11 0.17
12 0.2
13 0.19
14 0.21
15 0.2
16 0.19
17 0.21
18 0.21
19 0.2
20 0.18
21 0.18
22 0.17
23 0.14
24 0.16
25 0.16
26 0.18
27 0.19
28 0.2
29 0.18
30 0.18
31 0.19
32 0.14
33 0.11
34 0.08
35 0.07
36 0.08
37 0.08
38 0.07
39 0.07
40 0.08
41 0.09
42 0.09
43 0.13
44 0.13
45 0.15
46 0.15
47 0.15
48 0.18
49 0.2
50 0.25
51 0.22
52 0.23
53 0.31
54 0.38
55 0.46
56 0.52
57 0.58
58 0.63
59 0.72
60 0.81
61 0.83
62 0.86
63 0.86
64 0.86
65 0.85
66 0.79
67 0.7