Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XC09

Protein Details
Accession A0A0J0XC09   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-73DIFAAPKPKKDKGKKRDDKKAKVEEAARRSEVKEKKKKKEREKGKEKHQEEEBasic
NLS Segment(s)
PositionSequence
27-68PKPKKDKGKKRDDKKAKVEEAARRSEVKEKKKKKEREKGKEK
Subcellular Location(s) cyto 15.5, cyto_nucl 14, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MADKDKKGKDKAVAADAGAIDDIFAAPKPKKDKGKKRDDKKAKVEEAARRSEVKEKKKKKEREKGKEKHQEEEPESGAVEEVVDPSVAVVAALGRAKEARASGKRDRKEVEEDRMWRDSRGDADRKRTEEGYFVFKEAELGIDPEAGGTPLCPFDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.35
4 0.29
5 0.21
6 0.15
7 0.08
8 0.07
9 0.07
10 0.05
11 0.05
12 0.09
13 0.11
14 0.17
15 0.23
16 0.31
17 0.42
18 0.53
19 0.63
20 0.69
21 0.8
22 0.84
23 0.89
24 0.92
25 0.92
26 0.92
27 0.91
28 0.9
29 0.82
30 0.78
31 0.74
32 0.71
33 0.66
34 0.6
35 0.53
36 0.44
37 0.42
38 0.45
39 0.46
40 0.48
41 0.53
42 0.58
43 0.67
44 0.76
45 0.85
46 0.87
47 0.89
48 0.9
49 0.91
50 0.92
51 0.9
52 0.91
53 0.91
54 0.82
55 0.76
56 0.7
57 0.65
58 0.57
59 0.51
60 0.41
61 0.31
62 0.29
63 0.23
64 0.18
65 0.11
66 0.08
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.02
77 0.02
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.08
86 0.14
87 0.18
88 0.25
89 0.35
90 0.44
91 0.46
92 0.5
93 0.51
94 0.48
95 0.53
96 0.52
97 0.5
98 0.49
99 0.5
100 0.5
101 0.52
102 0.48
103 0.4
104 0.36
105 0.3
106 0.28
107 0.33
108 0.37
109 0.36
110 0.45
111 0.51
112 0.52
113 0.54
114 0.5
115 0.43
116 0.4
117 0.38
118 0.36
119 0.31
120 0.29
121 0.25
122 0.23
123 0.23
124 0.18
125 0.17
126 0.1
127 0.1
128 0.1
129 0.09
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.06
136 0.07
137 0.09
138 0.1
139 0.11
140 0.12