Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XZ48

Protein Details
Accession A0A0J0XZ48   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-74DDRLPRGHVRPVRRRIRRDDTNDPNPGABasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2, nucl 1, plas 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005552  Scramblase  
IPR025659  Tubby-like_C  
Gene Ontology GO:0017128  F:phospholipid scramblase activity  
Pfam View protein in Pfam  
PF03803  Scramblase  
Amino Acid Sequences MMMRTGLAAVRPALRLQPPLRRALPPLAGATLARQLSASTPLLRRDDDRLPRGHVRPVRRRIRRDDTNDPNPGAYQFQQDPLGSMGFDQQGYTQGYSARPAVVVPDDPRGVLQRNHAAYELLAHDSLVVVRQLEMMNVFLGYEQANRYAIYSPEGAHVGFLAEEERGFAGVLTRQILHTHRPFKSTVMDRHGTPILWIERPFAFINSRIRVRANPDLGAVGGGDGLSPLVGETQQQWHPWRRRYNLFENRVGGGDNYMDQFARIDGGFLAWDFWLTDADGRLLATINRNFTGFGREIFTDTGQYVIRFDAAGSEINMPPGSQVSVQGQTLVLPEESTGLTLDQRAMTLATAVSIDFDYFSRHSGSGGGFLPFWLFSGGDGSSEHSRGGEAPAPSGSGTGVGTGGGTGAGDVLGGAAAGAAMGGAGGYSGRDWSDDEIYGRAPPPGQTTADPFPGQSTPDRPYEPPAPGQQAEGFDYPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.36
4 0.44
5 0.45
6 0.52
7 0.55
8 0.53
9 0.54
10 0.54
11 0.52
12 0.45
13 0.43
14 0.36
15 0.33
16 0.3
17 0.27
18 0.26
19 0.21
20 0.18
21 0.15
22 0.15
23 0.16
24 0.2
25 0.21
26 0.2
27 0.24
28 0.29
29 0.33
30 0.34
31 0.35
32 0.36
33 0.43
34 0.47
35 0.5
36 0.48
37 0.52
38 0.58
39 0.59
40 0.62
41 0.59
42 0.61
43 0.65
44 0.72
45 0.76
46 0.77
47 0.83
48 0.83
49 0.87
50 0.86
51 0.84
52 0.85
53 0.84
54 0.83
55 0.8
56 0.71
57 0.62
58 0.52
59 0.45
60 0.37
61 0.29
62 0.26
63 0.21
64 0.23
65 0.25
66 0.24
67 0.24
68 0.22
69 0.21
70 0.15
71 0.14
72 0.14
73 0.13
74 0.13
75 0.11
76 0.1
77 0.14
78 0.17
79 0.17
80 0.15
81 0.16
82 0.17
83 0.19
84 0.19
85 0.15
86 0.13
87 0.12
88 0.14
89 0.13
90 0.16
91 0.15
92 0.19
93 0.19
94 0.19
95 0.2
96 0.21
97 0.22
98 0.22
99 0.25
100 0.28
101 0.3
102 0.31
103 0.31
104 0.28
105 0.24
106 0.24
107 0.2
108 0.14
109 0.12
110 0.11
111 0.1
112 0.1
113 0.1
114 0.08
115 0.07
116 0.06
117 0.06
118 0.08
119 0.08
120 0.08
121 0.09
122 0.08
123 0.08
124 0.07
125 0.07
126 0.05
127 0.06
128 0.06
129 0.07
130 0.07
131 0.08
132 0.09
133 0.09
134 0.11
135 0.12
136 0.12
137 0.13
138 0.13
139 0.12
140 0.13
141 0.14
142 0.13
143 0.11
144 0.1
145 0.08
146 0.07
147 0.06
148 0.05
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.07
158 0.08
159 0.09
160 0.09
161 0.09
162 0.12
163 0.14
164 0.19
165 0.25
166 0.32
167 0.32
168 0.35
169 0.35
170 0.35
171 0.4
172 0.4
173 0.39
174 0.38
175 0.39
176 0.36
177 0.39
178 0.38
179 0.31
180 0.24
181 0.23
182 0.18
183 0.18
184 0.19
185 0.17
186 0.16
187 0.19
188 0.2
189 0.16
190 0.15
191 0.17
192 0.23
193 0.24
194 0.26
195 0.24
196 0.25
197 0.25
198 0.3
199 0.33
200 0.29
201 0.25
202 0.24
203 0.23
204 0.21
205 0.2
206 0.14
207 0.06
208 0.04
209 0.03
210 0.03
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.03
219 0.04
220 0.08
221 0.1
222 0.13
223 0.17
224 0.25
225 0.32
226 0.39
227 0.46
228 0.48
229 0.54
230 0.58
231 0.66
232 0.67
233 0.65
234 0.62
235 0.56
236 0.51
237 0.43
238 0.37
239 0.26
240 0.16
241 0.11
242 0.08
243 0.07
244 0.06
245 0.06
246 0.05
247 0.06
248 0.05
249 0.06
250 0.05
251 0.05
252 0.04
253 0.05
254 0.05
255 0.05
256 0.05
257 0.04
258 0.04
259 0.04
260 0.04
261 0.05
262 0.05
263 0.06
264 0.05
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.07
271 0.11
272 0.13
273 0.14
274 0.15
275 0.15
276 0.16
277 0.16
278 0.2
279 0.15
280 0.14
281 0.14
282 0.14
283 0.16
284 0.16
285 0.16
286 0.12
287 0.11
288 0.12
289 0.1
290 0.1
291 0.09
292 0.08
293 0.08
294 0.07
295 0.07
296 0.07
297 0.07
298 0.08
299 0.09
300 0.11
301 0.11
302 0.12
303 0.12
304 0.11
305 0.1
306 0.1
307 0.09
308 0.07
309 0.08
310 0.1
311 0.13
312 0.13
313 0.13
314 0.12
315 0.12
316 0.12
317 0.11
318 0.08
319 0.06
320 0.06
321 0.07
322 0.07
323 0.07
324 0.07
325 0.06
326 0.07
327 0.07
328 0.09
329 0.07
330 0.08
331 0.08
332 0.07
333 0.07
334 0.07
335 0.06
336 0.05
337 0.05
338 0.05
339 0.06
340 0.06
341 0.06
342 0.06
343 0.06
344 0.09
345 0.1
346 0.11
347 0.13
348 0.13
349 0.13
350 0.15
351 0.15
352 0.15
353 0.16
354 0.15
355 0.13
356 0.13
357 0.13
358 0.11
359 0.11
360 0.08
361 0.07
362 0.06
363 0.09
364 0.09
365 0.09
366 0.09
367 0.12
368 0.14
369 0.14
370 0.14
371 0.12
372 0.12
373 0.13
374 0.16
375 0.17
376 0.15
377 0.16
378 0.16
379 0.17
380 0.16
381 0.16
382 0.12
383 0.08
384 0.08
385 0.07
386 0.07
387 0.06
388 0.06
389 0.05
390 0.05
391 0.04
392 0.04
393 0.03
394 0.03
395 0.03
396 0.03
397 0.03
398 0.03
399 0.02
400 0.02
401 0.02
402 0.02
403 0.02
404 0.02
405 0.02
406 0.02
407 0.02
408 0.02
409 0.01
410 0.01
411 0.02
412 0.02
413 0.03
414 0.03
415 0.04
416 0.05
417 0.06
418 0.08
419 0.11
420 0.14
421 0.16
422 0.17
423 0.18
424 0.19
425 0.21
426 0.2
427 0.19
428 0.17
429 0.17
430 0.21
431 0.23
432 0.25
433 0.25
434 0.31
435 0.34
436 0.38
437 0.36
438 0.31
439 0.3
440 0.29
441 0.29
442 0.28
443 0.28
444 0.27
445 0.32
446 0.36
447 0.35
448 0.4
449 0.44
450 0.44
451 0.44
452 0.48
453 0.49
454 0.46
455 0.47
456 0.44
457 0.4
458 0.4