Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XRA7

Protein Details
Accession A0A0J0XRA7    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-68DDDAPARQRKRDRFRGLAHRLBasic
NLS Segment(s)
Subcellular Location(s) extr 6, E.R. 6, cyto 5.5, cyto_nucl 4, pero 4, mito 2, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
Amino Acid Sequences VQAELELIPFVDVLFGGLLASIVVCETCKSVSHTYEGFLDLSLSMRGDDDAPARQRKRDRFRGLAHRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.04
6 0.03
7 0.03
8 0.02
9 0.02
10 0.03
11 0.03
12 0.03
13 0.04
14 0.05
15 0.06
16 0.11
17 0.14
18 0.15
19 0.17
20 0.17
21 0.17
22 0.17
23 0.17
24 0.13
25 0.1
26 0.09
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.08
36 0.09
37 0.14
38 0.2
39 0.29
40 0.31
41 0.37
42 0.46
43 0.55
44 0.64
45 0.69
46 0.73
47 0.73
48 0.8