Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XGR9

Protein Details
Accession A0A0J0XGR9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-47KVKSQTPKVEKQEKKKSPKGRAKKRAQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
11-38AGKVKSQTPKVEKQEKKKSPKGRAKKRA
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKSPKGRAKKRAQYTRRFVNVTLTPGGKRSMNQQPAGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.46
4 0.5
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.75
11 0.78
12 0.79
13 0.81
14 0.81
15 0.82
16 0.82
17 0.85
18 0.86
19 0.86
20 0.87
21 0.88
22 0.88
23 0.89
24 0.89
25 0.87
26 0.86
27 0.82
28 0.81
29 0.76
30 0.69
31 0.59
32 0.56
33 0.5
34 0.44
35 0.4
36 0.32
37 0.27
38 0.26
39 0.28
40 0.22
41 0.2
42 0.24
43 0.31
44 0.36
45 0.42
46 0.46