Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XM26

Protein Details
Accession A0A0J0XM26    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-51KTFIIKQKLAKKARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences QPSQKTFIIKQKLAKKARQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.73
4 0.79
5 0.8
6 0.78
7 0.77
8 0.8
9 0.82
10 0.76
11 0.71
12 0.69
13 0.61
14 0.59
15 0.57
16 0.5
17 0.43
18 0.48
19 0.51
20 0.45
21 0.51
22 0.53
23 0.57
24 0.64
25 0.69
26 0.7
27 0.74
28 0.77
29 0.81
30 0.84
31 0.84