Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XBZ5

Protein Details
Accession A0A0J0XBZ5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-23ALLLWRKRRSHPHYRVVPRGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MTALLLWRKRRSHPHYRVVPRGASSRALAGRHRHSRSTCEGITYFSDTAPRGVQGVAYART
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.82
4 0.83
5 0.76
6 0.7
7 0.61
8 0.55
9 0.46
10 0.38
11 0.3
12 0.25
13 0.24
14 0.23
15 0.24
16 0.25
17 0.31
18 0.37
19 0.39
20 0.4
21 0.39
22 0.43
23 0.46
24 0.47
25 0.39
26 0.34
27 0.32
28 0.3
29 0.31
30 0.3
31 0.24
32 0.17
33 0.2
34 0.17
35 0.18
36 0.17
37 0.15
38 0.12
39 0.12
40 0.12
41 0.13