Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XVJ9

Protein Details
Accession A0A0J0XVJ9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-55KPSDYPSPPKRSPKKKEASVVDHydrophilic
NLS Segment(s)
PositionSequence
43-48KRSPKK
Subcellular Location(s) nucl 10, mito 6, plas 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPVTFSEPSGRRMSTGRRPSASSPYPVRVMTSIKPSDYPSPPKRSPKKKEASVVDPFVDDAAPQCCPDLDCHTNSPQDERVALPADSERQPLLGRTQKRRARHWSLLAGLVLVLVVGSVIVGGVARMHSQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.53
4 0.51
5 0.55
6 0.57
7 0.62
8 0.57
9 0.53
10 0.49
11 0.46
12 0.46
13 0.41
14 0.39
15 0.32
16 0.32
17 0.28
18 0.31
19 0.29
20 0.27
21 0.28
22 0.3
23 0.34
24 0.36
25 0.42
26 0.42
27 0.49
28 0.54
29 0.63
30 0.7
31 0.75
32 0.78
33 0.79
34 0.81
35 0.79
36 0.81
37 0.76
38 0.73
39 0.68
40 0.62
41 0.52
42 0.42
43 0.35
44 0.26
45 0.2
46 0.13
47 0.08
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.08
55 0.14
56 0.15
57 0.17
58 0.19
59 0.22
60 0.24
61 0.24
62 0.25
63 0.21
64 0.19
65 0.18
66 0.16
67 0.16
68 0.16
69 0.15
70 0.13
71 0.12
72 0.15
73 0.15
74 0.16
75 0.13
76 0.12
77 0.13
78 0.13
79 0.19
80 0.24
81 0.3
82 0.37
83 0.48
84 0.53
85 0.58
86 0.66
87 0.68
88 0.7
89 0.71
90 0.7
91 0.66
92 0.62
93 0.59
94 0.51
95 0.41
96 0.31
97 0.22
98 0.15
99 0.08
100 0.05
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.04
112 0.05