Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1BEL3

Protein Details
Accession A0A0J1BEL3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
94-113GETYRSSRKNEKRRDQVTDRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010754  OPA3-like  
Pfam View protein in Pfam  
PF07047  OPA3  
Amino Acid Sequences MASVKIFSLAVKTLAKPIASTIKQQAVTHDSFRRICVNFAQQLMHRTEARMRMGLLNEEAKNIKPLNEAKAVQNGASMMAESFLFALGASLVLGETYRSSRKNEKRRDQVTDRLEDLEAAVEKLNEHAAQDVRHLQERSEALERTLKTVVSNGLRAGWLSLGHHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.24
5 0.3
6 0.29
7 0.33
8 0.33
9 0.38
10 0.4
11 0.4
12 0.41
13 0.37
14 0.39
15 0.4
16 0.39
17 0.38
18 0.36
19 0.38
20 0.39
21 0.34
22 0.33
23 0.32
24 0.34
25 0.32
26 0.32
27 0.33
28 0.29
29 0.32
30 0.32
31 0.3
32 0.24
33 0.22
34 0.26
35 0.28
36 0.28
37 0.25
38 0.23
39 0.23
40 0.23
41 0.23
42 0.21
43 0.2
44 0.18
45 0.18
46 0.18
47 0.16
48 0.18
49 0.17
50 0.16
51 0.16
52 0.18
53 0.2
54 0.24
55 0.25
56 0.24
57 0.28
58 0.28
59 0.23
60 0.21
61 0.17
62 0.12
63 0.11
64 0.1
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.03
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.03
82 0.03
83 0.06
84 0.09
85 0.11
86 0.15
87 0.25
88 0.35
89 0.45
90 0.56
91 0.64
92 0.71
93 0.76
94 0.81
95 0.76
96 0.76
97 0.71
98 0.65
99 0.56
100 0.47
101 0.41
102 0.32
103 0.26
104 0.19
105 0.14
106 0.1
107 0.09
108 0.08
109 0.08
110 0.08
111 0.1
112 0.08
113 0.08
114 0.1
115 0.12
116 0.13
117 0.16
118 0.2
119 0.21
120 0.27
121 0.27
122 0.24
123 0.29
124 0.29
125 0.31
126 0.31
127 0.29
128 0.25
129 0.31
130 0.31
131 0.29
132 0.29
133 0.24
134 0.2
135 0.22
136 0.26
137 0.24
138 0.26
139 0.23
140 0.23
141 0.23
142 0.22
143 0.2
144 0.15
145 0.13