Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XGV9

Protein Details
Accession A0A0J0XGV9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYTKGRVLGHKRGKRNSRPNQSLVHydrophilic
NLS Segment(s)
PositionSequence
16-19KRGK
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGATRLYTKGRVLGHKRGKRNSRPNQSLVAIEGVDTAEAARSYLGKRIAYVYKAKREINGSRVRVIWGRISRPHGNSGVVKSKFTSNLPAKVFGASCRIMLFPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.86
10 0.85
11 0.8
12 0.75
13 0.66
14 0.56
15 0.47
16 0.37
17 0.26
18 0.18
19 0.15
20 0.1
21 0.07
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.1
31 0.13
32 0.12
33 0.13
34 0.16
35 0.18
36 0.2
37 0.27
38 0.28
39 0.32
40 0.36
41 0.36
42 0.35
43 0.38
44 0.39
45 0.39
46 0.43
47 0.38
48 0.36
49 0.36
50 0.35
51 0.32
52 0.3
53 0.29
54 0.24
55 0.26
56 0.29
57 0.35
58 0.38
59 0.39
60 0.41
61 0.36
62 0.36
63 0.34
64 0.36
65 0.38
66 0.34
67 0.33
68 0.3
69 0.32
70 0.32
71 0.3
72 0.35
73 0.31
74 0.38
75 0.39
76 0.41
77 0.38
78 0.38
79 0.37
80 0.29
81 0.29
82 0.22
83 0.21
84 0.19
85 0.18
86 0.17