Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XVF2

Protein Details
Accession A0A0J0XVF2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-46ASTIPIVKKRTKTFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
10-19KRTKTFKRHQ
22-48RYHSVKESWRKPKGIDNRVRRRFKGQT
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASTIPIVKKRTKTFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHLIPSGHKEVLVHNVRDLELLLMHSGKYAAAVAHGVSSKKRIEIVARAKLIGVKITNAAAKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.89
5 0.88
6 0.88
7 0.87
8 0.86
9 0.82
10 0.76
11 0.67
12 0.63
13 0.63
14 0.62
15 0.62
16 0.64
17 0.62
18 0.6
19 0.61
20 0.65
21 0.66
22 0.67
23 0.67
24 0.68
25 0.72
26 0.8
27 0.84
28 0.77
29 0.75
30 0.72
31 0.69
32 0.69
33 0.66
34 0.67
35 0.68
36 0.71
37 0.65
38 0.58
39 0.51
40 0.45
41 0.46
42 0.41
43 0.41
44 0.44
45 0.45
46 0.46
47 0.49
48 0.46
49 0.43
50 0.41
51 0.39
52 0.37
53 0.44
54 0.48
55 0.44
56 0.42
57 0.36
58 0.33
59 0.36
60 0.32
61 0.23
62 0.19
63 0.2
64 0.2
65 0.2
66 0.19
67 0.1
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.04
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.1
85 0.1
86 0.14
87 0.15
88 0.16
89 0.17
90 0.18
91 0.21
92 0.3
93 0.38
94 0.42
95 0.43
96 0.42
97 0.41
98 0.41
99 0.37
100 0.32
101 0.24
102 0.17
103 0.17
104 0.19
105 0.21
106 0.2
107 0.21
108 0.19
109 0.19