Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XRS8

Protein Details
Accession A0A0J0XRS8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
220-245AWQWDEPKKKRLRKVGEKRKKAVSAKBasic
NLS Segment(s)
PositionSequence
226-251PKKKRLRKVGEKRKKAVSAKEKGPAL
Subcellular Location(s) plas 24, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004728  Sec62  
IPR011553  Sec62_asco  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03839  Sec62  
Amino Acid Sequences MPAPSDATSLADAQKRATPEHKVVIDFLRGKNGPKVRRGVLNGKRVDFFKGKTAVRTLMGPAYQKLGKKVPPVQTEEEAAALITSLLPFAYFLRVDRLNPNPPIPSGMPKPLGLSQQQQFDPAGYYSWFYDGSPFWNIVGGIAMVAVMLAGVMFPLWPVKLRIGVWYLSVGALGLVGLFIVIAIVRLILWCITKIFMTKAIWIFPNLFEDVGFVDSFIPAWQWDEPKKKRLRKVGEKRKKAVSAKEKGPALAARPPNAIPSAVGTADPAAAASEAARAPTPGNADTESGVAGSPSVSTATTTAIAPPATKPTPRSRQAATVEEVDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.3
4 0.33
5 0.35
6 0.36
7 0.44
8 0.45
9 0.43
10 0.43
11 0.42
12 0.45
13 0.43
14 0.38
15 0.39
16 0.37
17 0.39
18 0.44
19 0.49
20 0.48
21 0.5
22 0.55
23 0.51
24 0.57
25 0.61
26 0.63
27 0.64
28 0.66
29 0.65
30 0.61
31 0.6
32 0.53
33 0.52
34 0.46
35 0.39
36 0.37
37 0.4
38 0.38
39 0.39
40 0.42
41 0.38
42 0.35
43 0.35
44 0.29
45 0.26
46 0.26
47 0.24
48 0.21
49 0.23
50 0.25
51 0.25
52 0.28
53 0.3
54 0.32
55 0.37
56 0.45
57 0.49
58 0.51
59 0.56
60 0.56
61 0.52
62 0.49
63 0.42
64 0.34
65 0.25
66 0.19
67 0.13
68 0.08
69 0.06
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.04
76 0.05
77 0.07
78 0.07
79 0.08
80 0.13
81 0.15
82 0.17
83 0.21
84 0.27
85 0.31
86 0.33
87 0.34
88 0.31
89 0.3
90 0.33
91 0.29
92 0.28
93 0.25
94 0.28
95 0.28
96 0.26
97 0.28
98 0.27
99 0.28
100 0.25
101 0.27
102 0.26
103 0.3
104 0.29
105 0.28
106 0.26
107 0.23
108 0.22
109 0.17
110 0.14
111 0.09
112 0.1
113 0.08
114 0.1
115 0.09
116 0.08
117 0.1
118 0.09
119 0.11
120 0.12
121 0.12
122 0.1
123 0.11
124 0.11
125 0.09
126 0.09
127 0.06
128 0.04
129 0.04
130 0.04
131 0.03
132 0.02
133 0.02
134 0.01
135 0.01
136 0.01
137 0.01
138 0.01
139 0.01
140 0.01
141 0.02
142 0.02
143 0.03
144 0.04
145 0.05
146 0.06
147 0.08
148 0.09
149 0.11
150 0.12
151 0.13
152 0.12
153 0.12
154 0.11
155 0.09
156 0.08
157 0.06
158 0.04
159 0.03
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.01
166 0.01
167 0.01
168 0.01
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.03
175 0.03
176 0.04
177 0.04
178 0.05
179 0.05
180 0.06
181 0.07
182 0.08
183 0.12
184 0.12
185 0.16
186 0.16
187 0.18
188 0.18
189 0.18
190 0.18
191 0.15
192 0.16
193 0.13
194 0.12
195 0.1
196 0.1
197 0.1
198 0.09
199 0.09
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.05
206 0.04
207 0.06
208 0.08
209 0.12
210 0.19
211 0.29
212 0.34
213 0.43
214 0.53
215 0.6
216 0.66
217 0.73
218 0.77
219 0.78
220 0.85
221 0.87
222 0.88
223 0.89
224 0.86
225 0.84
226 0.82
227 0.76
228 0.75
229 0.74
230 0.72
231 0.68
232 0.69
233 0.62
234 0.53
235 0.5
236 0.41
237 0.35
238 0.34
239 0.32
240 0.28
241 0.29
242 0.29
243 0.28
244 0.28
245 0.24
246 0.17
247 0.16
248 0.16
249 0.14
250 0.14
251 0.12
252 0.11
253 0.11
254 0.1
255 0.07
256 0.05
257 0.05
258 0.05
259 0.05
260 0.07
261 0.07
262 0.08
263 0.08
264 0.09
265 0.09
266 0.12
267 0.15
268 0.14
269 0.16
270 0.17
271 0.18
272 0.18
273 0.18
274 0.15
275 0.12
276 0.11
277 0.08
278 0.07
279 0.06
280 0.05
281 0.05
282 0.06
283 0.06
284 0.07
285 0.08
286 0.1
287 0.11
288 0.11
289 0.12
290 0.13
291 0.14
292 0.14
293 0.15
294 0.21
295 0.24
296 0.27
297 0.32
298 0.4
299 0.49
300 0.54
301 0.58
302 0.55
303 0.6
304 0.63
305 0.63
306 0.56
307 0.5