Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XXX7

Protein Details
Accession A0A0J0XXX7    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-24TSTPNGPKGKGRPQNQRFERIKHydrophilic
63-85VTRGAGFRKEKNKKKRGSYAGGEBasic
NLS Segment(s)
PositionSequence
68-78GFRKEKNKKKR
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences SGTSTPNGPKGKGRPQNQRFERIKAQNVTFHDQRLMDNSFDAHIRNGASNNDFGARASRDLIVTRGAGFRKEKNKKKRGSYAGGEITLATNSIKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.81
4 0.79
5 0.81
6 0.74
7 0.72
8 0.73
9 0.69
10 0.68
11 0.62
12 0.59
13 0.54
14 0.55
15 0.54
16 0.46
17 0.4
18 0.34
19 0.29
20 0.27
21 0.26
22 0.23
23 0.17
24 0.15
25 0.15
26 0.13
27 0.13
28 0.13
29 0.09
30 0.08
31 0.08
32 0.09
33 0.09
34 0.1
35 0.11
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.11
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.12
48 0.13
49 0.11
50 0.11
51 0.11
52 0.13
53 0.13
54 0.16
55 0.19
56 0.25
57 0.35
58 0.45
59 0.54
60 0.62
61 0.71
62 0.76
63 0.82
64 0.86
65 0.84
66 0.82
67 0.78
68 0.76
69 0.71
70 0.63
71 0.53
72 0.43
73 0.35
74 0.27
75 0.21
76 0.13
77 0.08