Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J1B3K8

Protein Details
Accession A0A0J1B3K8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
164-196RSGMRGTRLRVKRARRRRRAKPRPRGCASPCWABasic
NLS Segment(s)
PositionSequence
138-188KRSGAAAPSRSSSRASARSSRSRACLRSGMRGTRLRVKRARRRRRAKPRPR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MRSAEDESSGSPFPPSVPTCSPRACLEDLARAHDLIDEAMMCAHPAPAGTAHPRASTPAYVTHFAPPTPWTRSPPSPPTAPRSRTRSKCKAARSCACTSSASRRPRPPCRTSRAQLTLRTRSSSASSPQRSTLQRTPKRSGAAAPSRSSSRASARSSRSRACLRSGMRGTRLRVKRARRRRRAKPRPRGCASPCWASRASALSLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.23
4 0.29
5 0.31
6 0.36
7 0.39
8 0.41
9 0.37
10 0.4
11 0.35
12 0.34
13 0.34
14 0.36
15 0.35
16 0.37
17 0.35
18 0.3
19 0.28
20 0.24
21 0.21
22 0.13
23 0.13
24 0.07
25 0.06
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.1
36 0.13
37 0.17
38 0.18
39 0.19
40 0.19
41 0.21
42 0.22
43 0.2
44 0.18
45 0.2
46 0.23
47 0.24
48 0.24
49 0.26
50 0.25
51 0.23
52 0.23
53 0.19
54 0.2
55 0.25
56 0.26
57 0.26
58 0.31
59 0.36
60 0.42
61 0.46
62 0.45
63 0.45
64 0.45
65 0.48
66 0.51
67 0.51
68 0.51
69 0.53
70 0.58
71 0.61
72 0.68
73 0.7
74 0.7
75 0.72
76 0.75
77 0.77
78 0.76
79 0.74
80 0.71
81 0.65
82 0.58
83 0.53
84 0.45
85 0.38
86 0.37
87 0.38
88 0.39
89 0.41
90 0.47
91 0.53
92 0.62
93 0.68
94 0.68
95 0.68
96 0.68
97 0.71
98 0.67
99 0.68
100 0.65
101 0.62
102 0.61
103 0.6
104 0.6
105 0.53
106 0.52
107 0.43
108 0.36
109 0.35
110 0.3
111 0.29
112 0.31
113 0.33
114 0.32
115 0.35
116 0.39
117 0.39
118 0.43
119 0.44
120 0.46
121 0.5
122 0.56
123 0.59
124 0.58
125 0.58
126 0.52
127 0.48
128 0.46
129 0.48
130 0.45
131 0.41
132 0.39
133 0.38
134 0.38
135 0.37
136 0.3
137 0.28
138 0.3
139 0.33
140 0.38
141 0.44
142 0.52
143 0.56
144 0.57
145 0.57
146 0.57
147 0.55
148 0.53
149 0.53
150 0.47
151 0.51
152 0.54
153 0.52
154 0.52
155 0.56
156 0.55
157 0.57
158 0.6
159 0.6
160 0.62
161 0.67
162 0.71
163 0.76
164 0.83
165 0.84
166 0.89
167 0.91
168 0.95
169 0.95
170 0.96
171 0.96
172 0.95
173 0.95
174 0.91
175 0.89
176 0.83
177 0.82
178 0.76
179 0.75
180 0.66
181 0.61
182 0.56
183 0.47
184 0.44
185 0.38
186 0.34