Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WDA6

Protein Details
Accession B2WDA6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-64NEAKAKQKSKKDHVLRNREDBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018860  APC_suCDC26  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF10471  ANAPC_CDC26  
Amino Acid Sequences MLRRAPTTITLTQTDIEQWEQDRKRKVQEAQQKLENEQRNAQSANEAKAKQKSKKDHVLRNREDFWVGFMRTWRLSLVEPSNRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.17
4 0.15
5 0.15
6 0.23
7 0.28
8 0.33
9 0.4
10 0.41
11 0.47
12 0.52
13 0.55
14 0.55
15 0.61
16 0.64
17 0.62
18 0.65
19 0.59
20 0.54
21 0.57
22 0.52
23 0.44
24 0.39
25 0.35
26 0.31
27 0.3
28 0.28
29 0.24
30 0.21
31 0.22
32 0.22
33 0.22
34 0.23
35 0.29
36 0.36
37 0.39
38 0.46
39 0.51
40 0.55
41 0.64
42 0.7
43 0.73
44 0.76
45 0.8
46 0.79
47 0.77
48 0.71
49 0.62
50 0.55
51 0.45
52 0.39
53 0.34
54 0.28
55 0.22
56 0.22
57 0.25
58 0.24
59 0.25
60 0.22
61 0.18
62 0.19
63 0.25
64 0.31
65 0.37