FuNGI

A0A0J0XY73

Protein Details

Accession

A0A0J0XY73

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
358-381	TDEDLERKRRERRRTRLPVGREED	Basic

NLS Segment(s)

Position	Sequence
218-228	KSAARKARLRR
364-373	RKRRERRRTR

Subcellular Location(s)

nucl 10, cyto 9.5, cyto_mito 8, mito 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR008603 DCTN4
Gene Ontology	GO:0005869 C:dynactin complex GO:0005815 C:microtubule organizing center GO:0030017 C:sarcomere
Pfam	View protein in Pfam PF05502 Dynactin_p62

Amino Acid Sequences

MPPSVLFHCAHQDTPHAPLPPAYASSFSAFSPLDTLYFCEECDAIRCDQCVVVEVASYYCPSCLFDVPSHNVRTDKNRCARSCFQCPQCSSGLATIASEASKDVKSEERTGGAPYFLICAACKWSSTEIGWLFDKPSGLAGQSERQFSQSELVQGEYDSLKDSLEKYMAQSAPPPPAQSTTTSKEKRLSHQRTPSRHLAQIAASRALGRDVPGLPPLKSAARKARLRREEGDKGGSARDEMPPYVAKGSWRDTGLERGLADVDAMREMDSEDIVVLERRWANAWDPERLAKKAIPSRVPLQTRQMKRCPSCRHTLVQPQPDAKSVRMPIKVVAFNYLPTVELGRRRRRISEELNEDATDEDLERKRRERRRTRLPVGREEDEPMATPLQAGEVYSFQLAFTNPLYDPIQIRLAAAHQPKPPVPANHHIFIPTAHFAVGALKDAWAYDEEDEDEGGSDEGLGVGADAGKGRMSLGAHRHRGRETGVEKRGNVTKVGIEVDVYKDASGPVEFDLEVRFTYRADDGEEGKDGTKAEYKTFMFWTRVCAGEVCE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.38
3	0.33
4	0.31
5	0.3
6	0.32
7	0.29
8	0.3
9	0.25
10	0.22
11	0.22
12	0.24
13	0.24
14	0.2
15	0.21
16	0.18
17	0.17
18	0.17
19	0.15
20	0.14
21	0.13
22	0.16
23	0.17
24	0.17
25	0.17
26	0.16
27	0.16
28	0.15
29	0.19
30	0.2
31	0.18
32	0.2
33	0.21
34	0.21
35	0.22
36	0.21
37	0.19
38	0.18
39	0.15
40	0.13
41	0.13
42	0.12
43	0.12
44	0.13
45	0.1
46	0.09
47	0.09
48	0.1
49	0.12
50	0.14
51	0.17
52	0.2
53	0.27
54	0.32
55	0.38
56	0.39
57	0.39
58	0.39
59	0.39
60	0.46
61	0.48
62	0.52
63	0.54
64	0.61
65	0.62
66	0.67
67	0.73
68	0.71
69	0.73
70	0.72
71	0.71
72	0.7
73	0.7
74	0.65
75	0.58
76	0.51
77	0.43
78	0.36
79	0.3
80	0.22
81	0.2
82	0.16
83	0.14
84	0.13
85	0.11
86	0.09
87	0.1
88	0.1
89	0.1
90	0.12
91	0.18
92	0.22
93	0.26
94	0.28
95	0.27
96	0.28
97	0.3
98	0.29
99	0.22
100	0.19
101	0.15
102	0.14
103	0.12
104	0.12
105	0.09
106	0.09
107	0.13
108	0.13
109	0.14
110	0.14
111	0.16
112	0.18
113	0.19
114	0.24
115	0.21
116	0.24
117	0.24
118	0.23
119	0.22
120	0.2
121	0.2
122	0.13
123	0.13
124	0.11
125	0.11
126	0.12
127	0.13
128	0.18
129	0.21
130	0.23
131	0.22
132	0.23
133	0.23
134	0.22
135	0.23
136	0.18
137	0.18
138	0.16
139	0.17
140	0.15
141	0.14
142	0.15
143	0.13
144	0.11
145	0.1
146	0.09
147	0.08
148	0.09
149	0.1
150	0.11
151	0.12
152	0.12
153	0.12
154	0.19
155	0.19
156	0.19
157	0.22
158	0.22
159	0.26
160	0.26
161	0.26
162	0.2
163	0.22
164	0.23
165	0.24
166	0.27
167	0.28
168	0.37
169	0.38
170	0.4
171	0.45
172	0.47
173	0.51
174	0.57
175	0.6
176	0.59
177	0.67
178	0.72
179	0.72
180	0.75
181	0.75
182	0.68
183	0.63
184	0.55
185	0.46
186	0.41
187	0.39
188	0.34
189	0.26
190	0.22
191	0.19
192	0.18
193	0.17
194	0.13
195	0.09
196	0.1
197	0.09
198	0.1
199	0.14
200	0.16
201	0.15
202	0.15
203	0.16
204	0.18
205	0.19
206	0.24
207	0.29
208	0.36
209	0.43
210	0.5
211	0.58
212	0.61
213	0.64
214	0.64
215	0.63
216	0.61
217	0.58
218	0.53
219	0.44
220	0.38
221	0.33
222	0.28
223	0.21
224	0.15
225	0.15
226	0.13
227	0.12
228	0.13
229	0.12
230	0.13
231	0.13
232	0.12
233	0.11
234	0.13
235	0.17
236	0.18
237	0.18
238	0.18
239	0.18
240	0.22
241	0.22
242	0.2
243	0.16
244	0.14
245	0.13
246	0.11
247	0.1
248	0.06
249	0.06
250	0.05
251	0.05
252	0.04
253	0.04
254	0.04
255	0.05
256	0.04
257	0.04
258	0.03
259	0.03
260	0.04
261	0.04
262	0.04
263	0.06
264	0.07
265	0.07
266	0.08
267	0.09
268	0.11
269	0.16
270	0.18
271	0.18
272	0.19
273	0.23
274	0.25
275	0.25
276	0.25
277	0.2
278	0.24
279	0.27
280	0.31
281	0.3
282	0.3
283	0.34
284	0.4
285	0.41
286	0.37
287	0.41
288	0.44
289	0.48
290	0.52
291	0.54
292	0.55
293	0.57
294	0.64
295	0.64
296	0.61
297	0.62
298	0.58
299	0.55
300	0.54
301	0.59
302	0.58
303	0.55
304	0.54
305	0.49
306	0.46
307	0.46
308	0.42
309	0.33
310	0.3
311	0.27
312	0.29
313	0.28
314	0.28
315	0.26
316	0.29
317	0.31
318	0.26
319	0.25
320	0.2
321	0.18
322	0.19
323	0.17
324	0.12
325	0.1
326	0.12
327	0.1
328	0.18
329	0.26
330	0.34
331	0.41
332	0.42
333	0.47
334	0.51
335	0.57
336	0.57
337	0.58
338	0.56
339	0.53
340	0.53
341	0.49
342	0.43
343	0.35
344	0.26
345	0.17
346	0.1
347	0.12
348	0.14
349	0.19
350	0.21
351	0.27
352	0.37
353	0.45
354	0.56
355	0.62
356	0.69
357	0.76
358	0.84
359	0.88
360	0.87
361	0.85
362	0.83
363	0.79
364	0.71
365	0.61
366	0.53
367	0.44
368	0.36
369	0.31
370	0.22
371	0.16
372	0.13
373	0.12
374	0.08
375	0.08
376	0.07
377	0.07
378	0.06
379	0.06
380	0.07
381	0.08
382	0.08
383	0.07
384	0.08
385	0.08
386	0.09
387	0.09
388	0.1
389	0.1
390	0.14
391	0.15
392	0.15
393	0.16
394	0.17
395	0.19
396	0.17
397	0.17
398	0.14
399	0.15
400	0.2
401	0.23
402	0.26
403	0.26
404	0.3
405	0.31
406	0.36
407	0.4
408	0.38
409	0.41
410	0.45
411	0.47
412	0.46
413	0.45
414	0.41
415	0.36
416	0.31
417	0.29
418	0.21
419	0.16
420	0.14
421	0.13
422	0.12
423	0.15
424	0.14
425	0.12
426	0.11
427	0.1
428	0.11
429	0.11
430	0.12
431	0.09
432	0.1
433	0.09
434	0.1
435	0.11
436	0.11
437	0.11
438	0.1
439	0.1
440	0.09
441	0.08
442	0.06
443	0.05
444	0.05
445	0.04
446	0.04
447	0.04
448	0.03
449	0.03
450	0.04
451	0.04
452	0.04
453	0.05
454	0.05
455	0.05
456	0.06
457	0.08
458	0.09
459	0.15
460	0.24
461	0.33
462	0.42
463	0.46
464	0.5
465	0.5
466	0.52
467	0.49
468	0.48
469	0.45
470	0.46
471	0.51
472	0.52
473	0.5
474	0.53
475	0.56
476	0.48
477	0.44
478	0.36
479	0.29
480	0.27
481	0.28
482	0.23
483	0.17
484	0.18
485	0.19
486	0.2
487	0.18
488	0.15
489	0.14
490	0.14
491	0.15
492	0.13
493	0.11
494	0.1
495	0.11
496	0.11
497	0.11
498	0.13
499	0.12
500	0.12
501	0.13
502	0.13
503	0.11
504	0.14
505	0.16
506	0.15
507	0.17
508	0.2
509	0.21
510	0.24
511	0.25
512	0.24
513	0.23
514	0.23
515	0.2
516	0.2
517	0.24
518	0.22
519	0.23
520	0.29
521	0.3
522	0.32
523	0.37
524	0.39
525	0.37
526	0.36
527	0.4
528	0.36
529	0.37
530	0.35

A0A0J0XY73

3D AlphaFold-predicted Structure Viewer