Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XSL5

Protein Details
Accession A0A0J0XSL5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
75-94RSPPRRVRVRLERKRNDDEGBasic
NLS Segment(s)
PositionSequence
76-88SPPRRVRVRLERK
Subcellular Location(s) nucl 9, mito 9, cyto 9, cyto_nucl 9, cyto_mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MAPTQKTRKQRSALQDVVTREYTINLHKRVHDLGFKKKAPKAVKSVTEFAQKAMGVKDVRISPALNQALWARGVRSPPRRVRVRLERKRNDDEGAKEKLYVVASVVEGVTSFKGLETVIVEGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.59
4 0.57
5 0.5
6 0.41
7 0.31
8 0.26
9 0.23
10 0.26
11 0.3
12 0.3
13 0.31
14 0.32
15 0.35
16 0.37
17 0.38
18 0.38
19 0.36
20 0.42
21 0.48
22 0.51
23 0.53
24 0.52
25 0.57
26 0.55
27 0.55
28 0.54
29 0.52
30 0.55
31 0.54
32 0.54
33 0.49
34 0.5
35 0.45
36 0.37
37 0.32
38 0.25
39 0.21
40 0.19
41 0.2
42 0.13
43 0.13
44 0.15
45 0.13
46 0.14
47 0.14
48 0.14
49 0.1
50 0.18
51 0.18
52 0.15
53 0.16
54 0.15
55 0.15
56 0.16
57 0.15
58 0.09
59 0.1
60 0.14
61 0.21
62 0.28
63 0.36
64 0.42
65 0.51
66 0.56
67 0.59
68 0.64
69 0.68
70 0.72
71 0.74
72 0.78
73 0.79
74 0.8
75 0.82
76 0.76
77 0.69
78 0.63
79 0.59
80 0.54
81 0.5
82 0.43
83 0.36
84 0.33
85 0.32
86 0.27
87 0.2
88 0.15
89 0.11
90 0.11
91 0.11
92 0.11
93 0.08
94 0.07
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.08
104 0.09