FuNGI

A0A0J0XLU8

Protein Details

Accession

A0A0J0XLU8

Localization Confidence

Low

Confidence Score

7.5

NoLS Segment(s)

Position	Sequence	Protein Nature
448-467	GAWRKWCDRYEKNPEKAMKR	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 9, nucl 8.5, cyto_nucl 8.5, cyto 7.5

Family & Domain DBs

Amino Acid Sequences

PSPSPSVSTPASLQPPSEDSYLRDPHRLIAYIVPFPAPADGPPPPTRFLVYTPPPPPLLAVADGKESKAHKVQRKWQEEVRAAHESNHKVLSWGGIRAKVTRGVDWAVGQVTTADLDFLVRVPKDGEVHHVRGRAASSVEAGRGAAKEAVVPAAEAGVNVQASASPPDDTAECTTAATPETATAHTTEAEAAQDRQGEADVAPPVYTPVDEPGPESASGCRQPTPPALPARRSGDAARPPPRRQDTLTIPLPHDEDPAAPESAAPTQATVKLNEMVLIYPPSLGLTEEELKTEFVNSLLRTKSKAQRDTVIATGLLPITFAIDWALMFVGWVFGGALEVDAVWLASSFRGAKTARSVTKRLTSSDADLKLTFKPSHRADLLQAYLQQRCAEADPRFPSVKMAPSSYDVLDSIGWEAAGKYDAHNWEDERWERRQVETDLATTMGKAAGAWRKWCDRYEKNPEKAMKR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.31
3	0.31
4	0.31
5	0.26
6	0.24
7	0.32
8	0.39
9	0.39
10	0.4
11	0.38
12	0.4
13	0.44
14	0.42
15	0.35
16	0.34
17	0.35
18	0.33
19	0.33
20	0.28
21	0.24
22	0.22
23	0.22
24	0.16
25	0.12
26	0.14
27	0.16
28	0.23
29	0.29
30	0.31
31	0.32
32	0.33
33	0.35
34	0.32
35	0.33
36	0.36
37	0.36
38	0.43
39	0.42
40	0.44
41	0.43
42	0.4
43	0.37
44	0.3
45	0.27
46	0.21
47	0.22
48	0.2
49	0.24
50	0.24
51	0.24
52	0.25
53	0.24
54	0.26
55	0.3
56	0.38
57	0.42
58	0.51
59	0.61
60	0.67
61	0.73
62	0.75
63	0.73
64	0.74
65	0.72
66	0.67
67	0.64
68	0.6
69	0.53
70	0.52
71	0.53
72	0.47
73	0.42
74	0.4
75	0.33
76	0.27
77	0.27
78	0.27
79	0.21
80	0.24
81	0.23
82	0.24
83	0.26
84	0.27
85	0.29
86	0.29
87	0.29
88	0.25
89	0.25
90	0.23
91	0.23
92	0.22
93	0.21
94	0.16
95	0.14
96	0.12
97	0.1
98	0.08
99	0.07
100	0.06
101	0.05
102	0.04
103	0.04
104	0.05
105	0.05
106	0.09
107	0.08
108	0.09
109	0.1
110	0.12
111	0.14
112	0.14
113	0.22
114	0.24
115	0.29
116	0.32
117	0.34
118	0.32
119	0.32
120	0.32
121	0.26
122	0.21
123	0.16
124	0.15
125	0.13
126	0.13
127	0.12
128	0.11
129	0.1
130	0.09
131	0.1
132	0.08
133	0.07
134	0.08
135	0.08
136	0.08
137	0.07
138	0.07
139	0.05
140	0.06
141	0.06
142	0.05
143	0.05
144	0.05
145	0.05
146	0.05
147	0.05
148	0.05
149	0.06
150	0.08
151	0.08
152	0.07
153	0.08
154	0.09
155	0.09
156	0.11
157	0.12
158	0.12
159	0.11
160	0.11
161	0.11
162	0.11
163	0.11
164	0.09
165	0.07
166	0.07
167	0.08
168	0.08
169	0.08
170	0.09
171	0.09
172	0.09
173	0.09
174	0.08
175	0.07
176	0.08
177	0.08
178	0.08
179	0.08
180	0.09
181	0.08
182	0.08
183	0.08
184	0.08
185	0.07
186	0.09
187	0.08
188	0.08
189	0.08
190	0.07
191	0.08
192	0.07
193	0.07
194	0.05
195	0.06
196	0.07
197	0.07
198	0.08
199	0.09
200	0.11
201	0.11
202	0.11
203	0.1
204	0.12
205	0.14
206	0.14
207	0.15
208	0.14
209	0.16
210	0.19
211	0.22
212	0.24
213	0.3
214	0.32
215	0.33
216	0.36
217	0.38
218	0.36
219	0.34
220	0.3
221	0.29
222	0.32
223	0.37
224	0.42
225	0.44
226	0.44
227	0.51
228	0.54
229	0.5
230	0.46
231	0.45
232	0.43
233	0.44
234	0.48
235	0.41
236	0.38
237	0.36
238	0.35
239	0.29
240	0.23
241	0.16
242	0.11
243	0.1
244	0.12
245	0.11
246	0.09
247	0.08
248	0.09
249	0.09
250	0.1
251	0.08
252	0.07
253	0.07
254	0.12
255	0.13
256	0.13
257	0.14
258	0.14
259	0.14
260	0.15
261	0.14
262	0.1
263	0.1
264	0.1
265	0.08
266	0.07
267	0.07
268	0.06
269	0.06
270	0.06
271	0.06
272	0.08
273	0.11
274	0.11
275	0.12
276	0.12
277	0.12
278	0.12
279	0.12
280	0.09
281	0.07
282	0.1
283	0.1
284	0.14
285	0.16
286	0.16
287	0.19
288	0.26
289	0.33
290	0.38
291	0.44
292	0.42
293	0.46
294	0.49
295	0.49
296	0.43
297	0.37
298	0.28
299	0.22
300	0.2
301	0.15
302	0.11
303	0.07
304	0.06
305	0.06
306	0.05
307	0.05
308	0.05
309	0.05
310	0.05
311	0.05
312	0.05
313	0.04
314	0.04
315	0.04
316	0.03
317	0.03
318	0.03
319	0.03
320	0.03
321	0.03
322	0.03
323	0.03
324	0.03
325	0.03
326	0.03
327	0.03
328	0.03
329	0.03
330	0.03
331	0.03
332	0.03
333	0.05
334	0.06
335	0.07
336	0.12
337	0.13
338	0.15
339	0.22
340	0.3
341	0.35
342	0.4
343	0.43
344	0.43
345	0.51
346	0.51
347	0.46
348	0.44
349	0.39
350	0.39
351	0.43
352	0.4
353	0.35
354	0.33
355	0.32
356	0.29
357	0.32
358	0.3
359	0.25
360	0.31
361	0.32
362	0.39
363	0.39
364	0.39
365	0.37
366	0.41
367	0.41
368	0.35
369	0.36
370	0.32
371	0.32
372	0.32
373	0.29
374	0.22
375	0.22
376	0.22
377	0.25
378	0.24
379	0.3
380	0.32
381	0.37
382	0.38
383	0.36
384	0.37
385	0.34
386	0.39
387	0.34
388	0.32
389	0.3
390	0.31
391	0.34
392	0.3
393	0.28
394	0.21
395	0.19
396	0.16
397	0.15
398	0.12
399	0.1
400	0.09
401	0.08
402	0.08
403	0.08
404	0.09
405	0.09
406	0.09
407	0.15
408	0.19
409	0.2
410	0.23
411	0.24
412	0.26
413	0.33
414	0.38
415	0.36
416	0.37
417	0.44
418	0.43
419	0.44
420	0.48
421	0.44
422	0.46
423	0.44
424	0.41
425	0.34
426	0.33
427	0.3
428	0.22
429	0.2
430	0.13
431	0.1
432	0.08
433	0.14
434	0.21
435	0.25
436	0.3
437	0.35
438	0.43
439	0.47
440	0.53
441	0.56
442	0.58
443	0.64
444	0.71
445	0.75
446	0.75
447	0.79

A0A0J0XLU8

3D AlphaFold-predicted Structure Viewer