Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VRF7

Protein Details
Accession B2VRF7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-43AKDGGEPKARVKRRNKHGWKGRQSRGRRSERKSKVRDBasic
NLS Segment(s)
PositionSequence
10-41GGEPKARVKRRNKHGWKGRQSRGRRSERKSKV
Subcellular Location(s) mito 10, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MDGRVAAKDGGEPKARVKRRNKHGWKGRQSRGRRSERKSKVRDGTANWELEVTALTAASLFGTGVGGERH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.52
4 0.59
5 0.64
6 0.7
7 0.81
8 0.83
9 0.83
10 0.88
11 0.9
12 0.9
13 0.89
14 0.88
15 0.86
16 0.82
17 0.82
18 0.81
19 0.81
20 0.79
21 0.75
22 0.78
23 0.78
24 0.82
25 0.78
26 0.76
27 0.73
28 0.71
29 0.68
30 0.62
31 0.6
32 0.55
33 0.49
34 0.4
35 0.33
36 0.27
37 0.22
38 0.18
39 0.1
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04