Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XPI1

Protein Details
Accession A0A0J0XPI1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-119AIGMSYQPSQRKRKRKHGFLARARTRLGRKMLARRRAKGRRFLSHHydrophilic
NLS Segment(s)
PositionSequence
85-116RKRKRKHGFLARARTRLGRKMLARRRAKGRRF
Subcellular Location(s) mito 17.5, mito_nucl 12.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPRAALALRAATPAAPRAPTLLLRPATASLRASPRPTSLLARLSPSALTAAPSPLAARLSPVFGQIQARGGAIGMSYQPSQRKRKRKHGFLARARTRLGRKMLARRRAKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.17
4 0.16
5 0.15
6 0.14
7 0.16
8 0.18
9 0.19
10 0.21
11 0.25
12 0.24
13 0.23
14 0.24
15 0.24
16 0.24
17 0.24
18 0.22
19 0.18
20 0.23
21 0.26
22 0.27
23 0.26
24 0.26
25 0.27
26 0.27
27 0.27
28 0.25
29 0.26
30 0.25
31 0.26
32 0.24
33 0.23
34 0.2
35 0.17
36 0.14
37 0.1
38 0.1
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.06
47 0.07
48 0.07
49 0.09
50 0.09
51 0.1
52 0.09
53 0.1
54 0.11
55 0.1
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.04
65 0.06
66 0.06
67 0.09
68 0.16
69 0.23
70 0.34
71 0.43
72 0.53
73 0.61
74 0.72
75 0.8
76 0.84
77 0.88
78 0.89
79 0.91
80 0.9
81 0.92
82 0.88
83 0.81
84 0.73
85 0.69
86 0.63
87 0.6
88 0.55
89 0.52
90 0.52
91 0.6
92 0.67
93 0.7
94 0.74
95 0.75
96 0.8
97 0.82
98 0.82
99 0.82