Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XYX0

Protein Details
Accession A0A0J0XYX0    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-36NACRPYPCCCRWRLRRVPRRPPPLLAPHydrophilic
162-184RLSLRLRRCRRGLHPCRRKLICVHydrophilic
NLS Segment(s)
PositionSequence
23-51LRRVPRRPPPLLAPVGRHRRLRGPVQPRH
133-137RRRPL
139-140GR
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences PHSHKTLDQNACRPYPCCCRWRLRRVPRRPPPLLAPVGRHRRLRGPVQPRHGLGVHLPHRREQVHGRVRCRASRYRGPVRCLHADHQPRGGRQDPGSRRPHPPDVRRCRRFALGRVLGLVGCRRDARCLVRPRRRPLVGRRRPFGVCRRFFCVCRRLRVCLRLSLRLRRCRRGLHPCRRKLICVCAFRQQHLGRRQGLALARRYRCRCRRVPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.51
4 0.49
5 0.51
6 0.57
7 0.65
8 0.75
9 0.79
10 0.8
11 0.84
12 0.89
13 0.94
14 0.93
15 0.93
16 0.87
17 0.81
18 0.76
19 0.74
20 0.7
21 0.62
22 0.58
23 0.58
24 0.63
25 0.63
26 0.6
27 0.55
28 0.55
29 0.58
30 0.6
31 0.6
32 0.61
33 0.63
34 0.67
35 0.7
36 0.63
37 0.6
38 0.52
39 0.43
40 0.35
41 0.36
42 0.36
43 0.37
44 0.37
45 0.36
46 0.4
47 0.4
48 0.42
49 0.39
50 0.42
51 0.45
52 0.51
53 0.51
54 0.55
55 0.57
56 0.58
57 0.57
58 0.54
59 0.52
60 0.55
61 0.6
62 0.62
63 0.64
64 0.64
65 0.64
66 0.62
67 0.6
68 0.54
69 0.47
70 0.46
71 0.47
72 0.44
73 0.46
74 0.44
75 0.39
76 0.4
77 0.41
78 0.34
79 0.3
80 0.37
81 0.35
82 0.41
83 0.47
84 0.46
85 0.49
86 0.51
87 0.59
88 0.57
89 0.61
90 0.63
91 0.67
92 0.75
93 0.74
94 0.71
95 0.64
96 0.63
97 0.58
98 0.52
99 0.51
100 0.43
101 0.39
102 0.37
103 0.34
104 0.27
105 0.24
106 0.21
107 0.11
108 0.09
109 0.1
110 0.1
111 0.12
112 0.15
113 0.2
114 0.27
115 0.37
116 0.47
117 0.55
118 0.64
119 0.68
120 0.74
121 0.74
122 0.72
123 0.73
124 0.74
125 0.75
126 0.74
127 0.69
128 0.65
129 0.62
130 0.61
131 0.6
132 0.59
133 0.56
134 0.52
135 0.55
136 0.54
137 0.54
138 0.55
139 0.55
140 0.5
141 0.53
142 0.53
143 0.54
144 0.58
145 0.63
146 0.58
147 0.58
148 0.57
149 0.57
150 0.59
151 0.62
152 0.64
153 0.67
154 0.71
155 0.7
156 0.71
157 0.69
158 0.73
159 0.74
160 0.76
161 0.78
162 0.81
163 0.81
164 0.86
165 0.81
166 0.77
167 0.71
168 0.71
169 0.68
170 0.64
171 0.59
172 0.6
173 0.59
174 0.55
175 0.59
176 0.54
177 0.54
178 0.55
179 0.59
180 0.52
181 0.52
182 0.5
183 0.46
184 0.47
185 0.44
186 0.45
187 0.48
188 0.51
189 0.58
190 0.64
191 0.7
192 0.73
193 0.76
194 0.77