Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1BC82

Protein Details
Accession A0A0J1BC82   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-159RSPRRRSYSRSRSPSPRRAAHydrophilic
168-223APARSPYRRRSPSPRRRSPSPRRRSPSPRRRSPSPRRRSPPPRRRSPSPRRPPAYGBasic
266-338YVRGGRSRSPPRRPLSRSRSPVRRRPLSRSRSRSPVRRRPVNRSRSRSPRRSPSRSRSRYSRSPSPRRRSVGMHydrophilic
NLS Segment(s)
PositionSequence
140-349RSPRRRSYSRSRSPSPRRAARSISPPVRAPARSPYRRRSPSPRRRSPSPRRRSPSPRRRSPSPRRRSPPPRRRSPSPRRPPAYGPNARGGRNGAGYGGGFGGGRFRSRSPPPHFRRGPPVRRPSPDYVRGGRSRSPPRRPLSRSRSPVRRRPLSRSRSRSPVRRRPVNRSRSRSPRRSPSRSRSRYSRSPSPRRRSVGMGSRSRSPSPRR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MSSRGRSPTPKRLTPTPGRPGKDVSMSPHPASPHPASASPNRAASPARPLAVVVVEGLSKNVGRAHLQEIFGEYGRVTGLDLPLFKVSGLNQGKAAIEFDRPAAAHDAVRCMNGGVLDGNVLTVQLSSHPLPSPQESPTRSPRRRSYSRSRSPSPRRAARSISPPVRAPARSPYRRRSPSPRRRSPSPRRRSPSPRRRSPSPRRRSPPPRRRSPSPRRPPAYGPNARGGRNGAGYGGGFGGGRFRSRSPPPHFRRGPPVRRPSPDYVRGGRSRSPPRRPLSRSRSPVRRRPLSRSRSRSPVRRRPVNRSRSRSPRRSPSRSRSRYSRSPSPRRRSVGMGSRSRSPSPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.77
4 0.77
5 0.73
6 0.7
7 0.67
8 0.62
9 0.58
10 0.51
11 0.47
12 0.48
13 0.5
14 0.48
15 0.46
16 0.43
17 0.38
18 0.43
19 0.39
20 0.35
21 0.33
22 0.34
23 0.36
24 0.41
25 0.45
26 0.42
27 0.41
28 0.36
29 0.35
30 0.34
31 0.32
32 0.34
33 0.31
34 0.29
35 0.26
36 0.26
37 0.25
38 0.23
39 0.21
40 0.12
41 0.09
42 0.09
43 0.08
44 0.09
45 0.08
46 0.07
47 0.08
48 0.1
49 0.11
50 0.12
51 0.15
52 0.2
53 0.23
54 0.24
55 0.24
56 0.24
57 0.24
58 0.23
59 0.2
60 0.15
61 0.11
62 0.1
63 0.09
64 0.07
65 0.07
66 0.08
67 0.1
68 0.1
69 0.12
70 0.12
71 0.12
72 0.12
73 0.11
74 0.1
75 0.19
76 0.21
77 0.2
78 0.2
79 0.21
80 0.22
81 0.21
82 0.22
83 0.13
84 0.11
85 0.11
86 0.11
87 0.12
88 0.11
89 0.12
90 0.14
91 0.14
92 0.14
93 0.15
94 0.18
95 0.17
96 0.17
97 0.16
98 0.12
99 0.12
100 0.1
101 0.1
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.04
113 0.07
114 0.08
115 0.1
116 0.1
117 0.11
118 0.13
119 0.16
120 0.18
121 0.18
122 0.24
123 0.25
124 0.3
125 0.39
126 0.48
127 0.5
128 0.55
129 0.61
130 0.64
131 0.69
132 0.72
133 0.73
134 0.73
135 0.79
136 0.79
137 0.77
138 0.78
139 0.8
140 0.81
141 0.78
142 0.75
143 0.71
144 0.67
145 0.65
146 0.59
147 0.57
148 0.57
149 0.52
150 0.46
151 0.41
152 0.39
153 0.38
154 0.34
155 0.28
156 0.29
157 0.34
158 0.4
159 0.46
160 0.51
161 0.58
162 0.63
163 0.66
164 0.68
165 0.7
166 0.72
167 0.77
168 0.8
169 0.77
170 0.8
171 0.86
172 0.86
173 0.86
174 0.85
175 0.84
176 0.81
177 0.83
178 0.85
179 0.86
180 0.85
181 0.85
182 0.84
183 0.81
184 0.83
185 0.85
186 0.86
187 0.85
188 0.85
189 0.84
190 0.81
191 0.85
192 0.87
193 0.88
194 0.87
195 0.86
196 0.87
197 0.84
198 0.87
199 0.88
200 0.88
201 0.88
202 0.88
203 0.88
204 0.81
205 0.78
206 0.75
207 0.73
208 0.72
209 0.68
210 0.6
211 0.58
212 0.58
213 0.54
214 0.49
215 0.41
216 0.33
217 0.27
218 0.24
219 0.15
220 0.12
221 0.11
222 0.1
223 0.08
224 0.06
225 0.05
226 0.05
227 0.08
228 0.08
229 0.09
230 0.11
231 0.12
232 0.19
233 0.25
234 0.35
235 0.4
236 0.51
237 0.57
238 0.66
239 0.69
240 0.67
241 0.73
242 0.74
243 0.75
244 0.75
245 0.78
246 0.75
247 0.76
248 0.79
249 0.76
250 0.74
251 0.71
252 0.68
253 0.62
254 0.62
255 0.61
256 0.58
257 0.55
258 0.56
259 0.59
260 0.62
261 0.67
262 0.68
263 0.71
264 0.77
265 0.78
266 0.8
267 0.78
268 0.79
269 0.78
270 0.79
271 0.83
272 0.82
273 0.84
274 0.83
275 0.84
276 0.8
277 0.81
278 0.82
279 0.82
280 0.83
281 0.83
282 0.8
283 0.8
284 0.82
285 0.83
286 0.83
287 0.83
288 0.83
289 0.85
290 0.85
291 0.86
292 0.88
293 0.88
294 0.88
295 0.86
296 0.86
297 0.86
298 0.9
299 0.89
300 0.88
301 0.88
302 0.88
303 0.9
304 0.9
305 0.9
306 0.91
307 0.89
308 0.88
309 0.87
310 0.85
311 0.85
312 0.83
313 0.83
314 0.82
315 0.85
316 0.88
317 0.88
318 0.88
319 0.84
320 0.8
321 0.76
322 0.74
323 0.73
324 0.72
325 0.71
326 0.65
327 0.67
328 0.68
329 0.66