Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VS25

Protein Details
Accession B2VS25   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-102GATKKTPSKKKTPTKRDVEDBasic
111-137AEQTPSKKPRARKPKTPKKAKAAVEVEHydrophilic
NLS Segment(s)
PositionSequence
91-92KK
116-131SKKPRARKPKTPKKAK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPKKAVSASGDVSEGPFKWEGPNDNKLLLITQGRYVKPEEYEQLTTAFPGTTIGSIRNRISALRVKQRDFYDSMGWTLPEGGATKKTPSKKKTPTKRDVEDAGVDDADDAEQTPSKKPRARKPKTPKKAKAAVEVEEGSESEEKKVKDEVGNEEDMGDLGVCRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.17
4 0.15
5 0.14
6 0.16
7 0.2
8 0.26
9 0.3
10 0.36
11 0.35
12 0.35
13 0.35
14 0.32
15 0.29
16 0.25
17 0.22
18 0.16
19 0.2
20 0.25
21 0.25
22 0.26
23 0.28
24 0.27
25 0.26
26 0.28
27 0.26
28 0.25
29 0.27
30 0.26
31 0.25
32 0.23
33 0.21
34 0.18
35 0.14
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.11
42 0.12
43 0.16
44 0.16
45 0.17
46 0.17
47 0.16
48 0.2
49 0.24
50 0.28
51 0.35
52 0.39
53 0.39
54 0.44
55 0.45
56 0.44
57 0.39
58 0.35
59 0.28
60 0.24
61 0.24
62 0.18
63 0.17
64 0.14
65 0.12
66 0.09
67 0.06
68 0.06
69 0.06
70 0.08
71 0.09
72 0.11
73 0.16
74 0.23
75 0.3
76 0.35
77 0.44
78 0.52
79 0.62
80 0.71
81 0.77
82 0.8
83 0.81
84 0.8
85 0.75
86 0.67
87 0.6
88 0.5
89 0.41
90 0.32
91 0.23
92 0.19
93 0.14
94 0.1
95 0.08
96 0.06
97 0.04
98 0.04
99 0.07
100 0.08
101 0.13
102 0.18
103 0.25
104 0.3
105 0.38
106 0.48
107 0.57
108 0.65
109 0.71
110 0.78
111 0.83
112 0.89
113 0.92
114 0.91
115 0.89
116 0.9
117 0.83
118 0.82
119 0.75
120 0.67
121 0.61
122 0.52
123 0.43
124 0.34
125 0.29
126 0.21
127 0.19
128 0.16
129 0.14
130 0.18
131 0.18
132 0.19
133 0.22
134 0.24
135 0.26
136 0.3
137 0.35
138 0.35
139 0.37
140 0.35
141 0.32
142 0.28
143 0.24
144 0.2
145 0.12