Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XCK5

Protein Details
Accession A0A0J0XCK5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-100YTTYDPKYQQHKWRKGVHKVPKWTKLTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGALRPSSVLNGGLLWKVPYRLSNTRKANLRQRLKRVDSVIAAVAESGVECRALTRALELPKESEMPAKDKYTTYDPKYQQHKWRKGVHKVPKWTKLTLRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.13
6 0.14
7 0.16
8 0.22
9 0.31
10 0.36
11 0.44
12 0.49
13 0.54
14 0.61
15 0.65
16 0.68
17 0.69
18 0.74
19 0.73
20 0.75
21 0.78
22 0.75
23 0.73
24 0.65
25 0.58
26 0.48
27 0.41
28 0.34
29 0.24
30 0.19
31 0.14
32 0.1
33 0.07
34 0.06
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.05
42 0.05
43 0.06
44 0.1
45 0.12
46 0.14
47 0.14
48 0.15
49 0.15
50 0.17
51 0.15
52 0.15
53 0.15
54 0.17
55 0.2
56 0.21
57 0.21
58 0.21
59 0.24
60 0.28
61 0.34
62 0.35
63 0.41
64 0.44
65 0.51
66 0.58
67 0.63
68 0.65
69 0.69
70 0.73
71 0.73
72 0.79
73 0.8
74 0.83
75 0.85
76 0.86
77 0.84
78 0.86
79 0.87
80 0.87
81 0.81
82 0.77
83 0.75
84 0.74
85 0.74
86 0.73
87 0.74