Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1B0C4

Protein Details
Accession A0A0J1B0C4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
172-200LTDFRTGPDRRRKRRRRRRSVSGGGRDEPBasic
NLS Segment(s)
PositionSequence
180-192DRRRKRRRRRRSV
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009450  Plno_GlcNAc_GPI2  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06432  GPI2  
Amino Acid Sequences MPPPAPVSAGGKHPHRPAVEWEKVLWRRQPFPDNYVPPSFLAELDALPQRPRPKLLPLILATLPVSQHLAVIALFLAIFYGMLVGNFGAAEVGWACATVGVVAYGLWRVGWEAAKKENVGPLLPATSALRPLLLPPLLLGLLAPVLGTLTSATTSDSIWPLAGLLFFVHLLLTDFRTGPDRRRKRRRRRRSVSGGGRDEPEEKSLTSSLSLTSALSASVVLASRLPSTGHVFSLVMLAAGLFAGWPNLAKGVREAGPAFSVALTFSMIWLSASLLPPSRHPTTLGPFPVPGGAARVFFAVLLLVNVGGPLMLWWGWRWKRRLGGNWDAAVVRVRKRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.46
4 0.49
5 0.53
6 0.55
7 0.5
8 0.48
9 0.52
10 0.55
11 0.58
12 0.56
13 0.52
14 0.52
15 0.57
16 0.64
17 0.59
18 0.61
19 0.66
20 0.64
21 0.64
22 0.61
23 0.55
24 0.45
25 0.44
26 0.37
27 0.26
28 0.22
29 0.17
30 0.14
31 0.15
32 0.18
33 0.16
34 0.17
35 0.22
36 0.26
37 0.28
38 0.32
39 0.33
40 0.37
41 0.44
42 0.47
43 0.5
44 0.46
45 0.48
46 0.43
47 0.41
48 0.34
49 0.26
50 0.22
51 0.15
52 0.15
53 0.09
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.02
67 0.03
68 0.03
69 0.03
70 0.04
71 0.03
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.06
97 0.09
98 0.11
99 0.13
100 0.16
101 0.19
102 0.19
103 0.2
104 0.21
105 0.19
106 0.17
107 0.15
108 0.13
109 0.12
110 0.11
111 0.11
112 0.1
113 0.09
114 0.1
115 0.09
116 0.09
117 0.08
118 0.09
119 0.12
120 0.1
121 0.1
122 0.08
123 0.09
124 0.09
125 0.08
126 0.08
127 0.04
128 0.04
129 0.04
130 0.03
131 0.02
132 0.02
133 0.02
134 0.03
135 0.02
136 0.03
137 0.03
138 0.04
139 0.04
140 0.05
141 0.05
142 0.06
143 0.07
144 0.07
145 0.06
146 0.06
147 0.05
148 0.05
149 0.05
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.04
158 0.04
159 0.05
160 0.06
161 0.06
162 0.07
163 0.12
164 0.13
165 0.2
166 0.31
167 0.4
168 0.5
169 0.61
170 0.72
171 0.79
172 0.9
173 0.93
174 0.94
175 0.94
176 0.94
177 0.93
178 0.93
179 0.91
180 0.89
181 0.82
182 0.72
183 0.63
184 0.53
185 0.45
186 0.35
187 0.26
188 0.18
189 0.13
190 0.14
191 0.13
192 0.12
193 0.11
194 0.1
195 0.09
196 0.09
197 0.09
198 0.07
199 0.07
200 0.07
201 0.06
202 0.05
203 0.05
204 0.04
205 0.05
206 0.05
207 0.04
208 0.05
209 0.06
210 0.06
211 0.07
212 0.07
213 0.08
214 0.13
215 0.14
216 0.13
217 0.14
218 0.13
219 0.13
220 0.14
221 0.11
222 0.07
223 0.06
224 0.05
225 0.04
226 0.04
227 0.03
228 0.02
229 0.02
230 0.02
231 0.03
232 0.03
233 0.03
234 0.07
235 0.07
236 0.08
237 0.09
238 0.13
239 0.14
240 0.17
241 0.17
242 0.15
243 0.16
244 0.16
245 0.15
246 0.11
247 0.09
248 0.07
249 0.07
250 0.07
251 0.06
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.07
258 0.09
259 0.1
260 0.12
261 0.16
262 0.17
263 0.2
264 0.26
265 0.28
266 0.26
267 0.28
268 0.32
269 0.34
270 0.41
271 0.41
272 0.37
273 0.34
274 0.33
275 0.31
276 0.26
277 0.2
278 0.16
279 0.14
280 0.13
281 0.13
282 0.13
283 0.12
284 0.11
285 0.11
286 0.07
287 0.06
288 0.06
289 0.05
290 0.05
291 0.05
292 0.05
293 0.04
294 0.04
295 0.03
296 0.03
297 0.05
298 0.05
299 0.06
300 0.08
301 0.18
302 0.26
303 0.33
304 0.38
305 0.43
306 0.51
307 0.6
308 0.68
309 0.67
310 0.7
311 0.71
312 0.68
313 0.63
314 0.55
315 0.47
316 0.43
317 0.38
318 0.33