Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XL46

Protein Details
Accession A0A0J0XL46   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
194-216DEPVPEEQKRKNRPPGNERLVVWHydrophilic
NLS Segment(s)
PositionSequence
203-209RKNRPPG
217-219KRK
Subcellular Location(s) pero 13, cyto 7, cyto_nucl 6.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR044995  TMT/HOL  
IPR008854  TPMT  
Gene Ontology GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF05724  TPMT  
PROSITE View protein in PROSITE  
PS51585  SAM_MT_TPMT  
Amino Acid Sequences MADVKATDEQNYPQMWEHRWDSKNTAWDQGKVHPALAAFLESQAAVDAGIPTTGRAFVPGCGQGYDVDLFARRGLDTTGLDVAPTGAKSADAWVKAQTGQKGRAEVVCGDFFKWTPEEKFDLIYDYTFLCALPPTLRPQWGQRMTELSKASPNSRLITLQYPLQGNPPPFGPPFALDESVYRDVLGDHWEAIYDEPVPEEQKRKNRPPGNERLVVWKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.33
4 0.36
5 0.4
6 0.42
7 0.44
8 0.45
9 0.46
10 0.52
11 0.48
12 0.52
13 0.46
14 0.47
15 0.46
16 0.46
17 0.47
18 0.4
19 0.38
20 0.3
21 0.27
22 0.24
23 0.22
24 0.17
25 0.1
26 0.1
27 0.1
28 0.08
29 0.08
30 0.07
31 0.06
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.06
42 0.08
43 0.08
44 0.09
45 0.12
46 0.14
47 0.14
48 0.14
49 0.15
50 0.13
51 0.14
52 0.14
53 0.11
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.07
60 0.08
61 0.08
62 0.1
63 0.09
64 0.1
65 0.11
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.07
72 0.06
73 0.04
74 0.05
75 0.05
76 0.07
77 0.1
78 0.1
79 0.11
80 0.11
81 0.12
82 0.15
83 0.17
84 0.19
85 0.2
86 0.24
87 0.25
88 0.25
89 0.25
90 0.23
91 0.22
92 0.18
93 0.17
94 0.15
95 0.13
96 0.12
97 0.12
98 0.11
99 0.11
100 0.12
101 0.11
102 0.1
103 0.13
104 0.15
105 0.15
106 0.16
107 0.15
108 0.16
109 0.15
110 0.14
111 0.12
112 0.09
113 0.09
114 0.08
115 0.07
116 0.05
117 0.05
118 0.06
119 0.06
120 0.08
121 0.13
122 0.15
123 0.17
124 0.18
125 0.23
126 0.32
127 0.37
128 0.36
129 0.33
130 0.38
131 0.37
132 0.42
133 0.38
134 0.29
135 0.28
136 0.29
137 0.29
138 0.28
139 0.29
140 0.25
141 0.25
142 0.25
143 0.23
144 0.25
145 0.24
146 0.21
147 0.22
148 0.21
149 0.2
150 0.23
151 0.25
152 0.22
153 0.22
154 0.2
155 0.2
156 0.2
157 0.21
158 0.18
159 0.16
160 0.19
161 0.21
162 0.22
163 0.19
164 0.2
165 0.24
166 0.26
167 0.24
168 0.19
169 0.16
170 0.15
171 0.16
172 0.18
173 0.12
174 0.1
175 0.1
176 0.1
177 0.11
178 0.11
179 0.11
180 0.09
181 0.08
182 0.09
183 0.11
184 0.14
185 0.18
186 0.24
187 0.31
188 0.4
189 0.51
190 0.59
191 0.68
192 0.73
193 0.8
194 0.83
195 0.86
196 0.84
197 0.8
198 0.72
199 0.72