Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1B016

Protein Details
Accession A0A0J1B016   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
107-132ALIGVILWRRRRRRRPRNVRLISDDVHydrophilic
NLS Segment(s)
PositionSequence
115-123RRRRRRRPR
Subcellular Location(s) nucl 7.5, cyto_nucl 6, mito 5, plas 5, extr 4, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDPSLTSGVSAPPTNEPFSDSFVHDSQSSPLLPLPSSLLSLLSQSGLQSTSPLPLIPPDPPRATSPSPTTPSASTTPSLESGTGAPSNATKALVGTIAALVTAGMLALIGVILWRRRRRRRPRNVRLISDDVHLEPFSFQDEFGTTHLLSMFPDAPSFSAAAQGGARRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.23
5 0.27
6 0.27
7 0.23
8 0.25
9 0.23
10 0.25
11 0.22
12 0.22
13 0.2
14 0.2
15 0.18
16 0.14
17 0.16
18 0.15
19 0.14
20 0.14
21 0.15
22 0.13
23 0.14
24 0.13
25 0.12
26 0.11
27 0.11
28 0.11
29 0.09
30 0.08
31 0.07
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.08
41 0.09
42 0.11
43 0.13
44 0.17
45 0.2
46 0.21
47 0.23
48 0.26
49 0.3
50 0.31
51 0.3
52 0.32
53 0.34
54 0.36
55 0.35
56 0.35
57 0.3
58 0.31
59 0.29
60 0.25
61 0.19
62 0.17
63 0.16
64 0.15
65 0.15
66 0.12
67 0.1
68 0.09
69 0.1
70 0.09
71 0.08
72 0.07
73 0.06
74 0.07
75 0.07
76 0.07
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.01
93 0.01
94 0.01
95 0.01
96 0.01
97 0.02
98 0.03
99 0.07
100 0.14
101 0.22
102 0.32
103 0.43
104 0.54
105 0.66
106 0.76
107 0.84
108 0.9
109 0.93
110 0.95
111 0.93
112 0.89
113 0.85
114 0.78
115 0.68
116 0.58
117 0.49
118 0.38
119 0.32
120 0.25
121 0.18
122 0.13
123 0.12
124 0.12
125 0.11
126 0.1
127 0.09
128 0.11
129 0.12
130 0.13
131 0.16
132 0.13
133 0.14
134 0.14
135 0.13
136 0.12
137 0.14
138 0.15
139 0.12
140 0.13
141 0.12
142 0.13
143 0.14
144 0.14
145 0.1
146 0.13
147 0.12
148 0.13
149 0.15