Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J1B3Q8

Protein Details
Accession A0A0J1B3Q8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSFPRPYQSPTPRRSRPRSASRRPATYRHydrophilic
NLS Segment(s)
PositionSequence
14-19RSRPRS
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSFPRPYQSPTPRRSRPRSASRRPATYRHNAPEFMRDRGLRSRCAARLSMEQGRTELRVGRPQIASVITPVGGGHMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.82
4 0.83
5 0.86
6 0.87
7 0.88
8 0.85
9 0.86
10 0.8
11 0.77
12 0.73
13 0.71
14 0.68
15 0.64
16 0.6
17 0.52
18 0.49
19 0.5
20 0.46
21 0.39
22 0.35
23 0.28
24 0.28
25 0.34
26 0.35
27 0.28
28 0.28
29 0.31
30 0.3
31 0.32
32 0.3
33 0.25
34 0.28
35 0.31
36 0.34
37 0.31
38 0.29
39 0.28
40 0.28
41 0.26
42 0.23
43 0.22
44 0.19
45 0.24
46 0.26
47 0.3
48 0.3
49 0.29
50 0.3
51 0.27
52 0.25
53 0.19
54 0.18
55 0.13
56 0.12
57 0.12