Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J1AT13

Protein Details
Accession A0A0J1AT13    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
136-160RVGGYGRRRGRRRCAQRERDTHAPPBasic
210-236HPKPLLPVGPRRLRQRRRPGLRDGVGGBasic
NLS Segment(s)
PositionSequence
136-148RVGGYGRRRGRRR
203-229RRVDAHAHPKPLLPVGPRRLRQRRRPG
Subcellular Location(s) mito 16, cyto_nucl 6.5, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MPMRKFSLSRKSSSSDVRGARARPPSAWTPGSGAGSPSPSPSPSPAPASAPAASTPEKRKPSIACVHTCPSSPQRQEQAPPLGHLRVAEEPRARARRRGGLAACVIALRARDGDHCRQPKPEREPKSQPQPRRCERVGGYGRRRGRRRCAQRERDTHAPPVPVDRPQHEHARDTHGIPSARDARAPAPRRAHCVRVLNTRRVRRVDAHAHPKPLLPVGPRRLRQRRRPGLRDGVGGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.5
4 0.52
5 0.52
6 0.5
7 0.51
8 0.51
9 0.48
10 0.41
11 0.43
12 0.42
13 0.43
14 0.42
15 0.37
16 0.33
17 0.34
18 0.35
19 0.3
20 0.26
21 0.21
22 0.23
23 0.21
24 0.2
25 0.18
26 0.17
27 0.19
28 0.21
29 0.24
30 0.24
31 0.29
32 0.28
33 0.29
34 0.3
35 0.32
36 0.29
37 0.25
38 0.23
39 0.21
40 0.22
41 0.24
42 0.28
43 0.33
44 0.37
45 0.37
46 0.42
47 0.41
48 0.47
49 0.51
50 0.51
51 0.47
52 0.48
53 0.5
54 0.46
55 0.44
56 0.4
57 0.37
58 0.4
59 0.38
60 0.38
61 0.4
62 0.43
63 0.45
64 0.47
65 0.49
66 0.4
67 0.39
68 0.36
69 0.31
70 0.28
71 0.25
72 0.21
73 0.19
74 0.19
75 0.22
76 0.21
77 0.22
78 0.3
79 0.37
80 0.36
81 0.36
82 0.39
83 0.42
84 0.43
85 0.48
86 0.41
87 0.37
88 0.37
89 0.32
90 0.27
91 0.19
92 0.16
93 0.11
94 0.1
95 0.06
96 0.05
97 0.05
98 0.09
99 0.13
100 0.19
101 0.26
102 0.3
103 0.31
104 0.38
105 0.42
106 0.47
107 0.52
108 0.56
109 0.55
110 0.59
111 0.66
112 0.66
113 0.73
114 0.72
115 0.72
116 0.72
117 0.74
118 0.72
119 0.72
120 0.65
121 0.6
122 0.55
123 0.57
124 0.56
125 0.56
126 0.56
127 0.56
128 0.62
129 0.64
130 0.69
131 0.65
132 0.67
133 0.68
134 0.73
135 0.76
136 0.81
137 0.83
138 0.86
139 0.88
140 0.85
141 0.83
142 0.75
143 0.69
144 0.61
145 0.52
146 0.42
147 0.4
148 0.35
149 0.31
150 0.31
151 0.29
152 0.32
153 0.34
154 0.42
155 0.39
156 0.4
157 0.37
158 0.42
159 0.41
160 0.36
161 0.36
162 0.33
163 0.32
164 0.29
165 0.33
166 0.31
167 0.29
168 0.28
169 0.27
170 0.26
171 0.35
172 0.4
173 0.41
174 0.44
175 0.46
176 0.53
177 0.56
178 0.56
179 0.53
180 0.57
181 0.55
182 0.57
183 0.62
184 0.64
185 0.69
186 0.72
187 0.72
188 0.68
189 0.67
190 0.61
191 0.64
192 0.63
193 0.64
194 0.67
195 0.65
196 0.65
197 0.61
198 0.57
199 0.51
200 0.44
201 0.39
202 0.33
203 0.37
204 0.42
205 0.51
206 0.55
207 0.64
208 0.72
209 0.78
210 0.83
211 0.85
212 0.87
213 0.88
214 0.89
215 0.87
216 0.87
217 0.81
218 0.76