Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WNN3

Protein Details
Accession B2WNN3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-113RIKHSKDTGLRPKNQRKIAKBasic
NLS Segment(s)
PositionSequence
103-117LRPKNQRKIAKAIRR
Subcellular Location(s) mito 13, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences MRFARDVGLDRASTTPSREWAESERLAQYQRQIYRKWQPGDVYAPHDLSGIEQKKWKQGRMKPQEDAFDILGINPVLEYKNFTMMSEYMTEMGRIKHSKDTGLRPKNQRKIAKAIRRAVGLGLMPSVHRHPLVLKKSSPARFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.27
5 0.26
6 0.28
7 0.29
8 0.35
9 0.33
10 0.33
11 0.31
12 0.29
13 0.3
14 0.29
15 0.29
16 0.31
17 0.35
18 0.38
19 0.38
20 0.44
21 0.52
22 0.59
23 0.56
24 0.53
25 0.48
26 0.47
27 0.51
28 0.46
29 0.4
30 0.34
31 0.31
32 0.27
33 0.25
34 0.21
35 0.16
36 0.22
37 0.19
38 0.19
39 0.22
40 0.23
41 0.32
42 0.35
43 0.4
44 0.4
45 0.44
46 0.54
47 0.61
48 0.65
49 0.61
50 0.61
51 0.58
52 0.5
53 0.46
54 0.35
55 0.25
56 0.19
57 0.14
58 0.12
59 0.09
60 0.07
61 0.04
62 0.05
63 0.04
64 0.05
65 0.07
66 0.07
67 0.12
68 0.12
69 0.12
70 0.14
71 0.14
72 0.15
73 0.14
74 0.14
75 0.1
76 0.1
77 0.11
78 0.1
79 0.1
80 0.14
81 0.14
82 0.16
83 0.2
84 0.21
85 0.26
86 0.3
87 0.4
88 0.46
89 0.53
90 0.59
91 0.64
92 0.74
93 0.77
94 0.81
95 0.79
96 0.73
97 0.75
98 0.78
99 0.77
100 0.76
101 0.74
102 0.69
103 0.63
104 0.58
105 0.48
106 0.4
107 0.31
108 0.22
109 0.16
110 0.12
111 0.11
112 0.13
113 0.15
114 0.15
115 0.14
116 0.14
117 0.19
118 0.29
119 0.36
120 0.4
121 0.4
122 0.45
123 0.54