Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1B3J9

Protein Details
Accession A0A0J1B3J9    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-60APAPSPSRPRFRKPSHAPWSLSHydrophilic
107-129TITKAPKTPKTPKTPKTPKTPKTHydrophilic
NLS Segment(s)
PositionSequence
5-8RRKP
115-122PKTPKTPK
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MAPRRRKPVAPKTAKTSKTAAASSAATAAPAASTSAPTAPAPSPSRPRFRKPSHAPWSLSPSPEPQGGQRDDDVDELDSDKPGSSPPGQPAAPTSPATGKSGTAGGTITKAPKTPKTPKTPKTPKTPKTAATGANPIQPASPAASQLASQSGTNIPAKPLDPVLPVSVGQLPPSQKGYYDSLFKCGQEFFDSHWATDDVWRSEGALRDYLTRLGHGNDPLTTVQPWYHSHDWLYPQEARQYGLERYIPSKPIELPLLSGTRMIRCRPNKVEHSQMADMTGEPDPSPRATCHSGCIPAFIYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.71
3 0.65
4 0.59
5 0.55
6 0.49
7 0.41
8 0.35
9 0.33
10 0.29
11 0.27
12 0.21
13 0.15
14 0.13
15 0.12
16 0.08
17 0.07
18 0.08
19 0.06
20 0.07
21 0.08
22 0.09
23 0.11
24 0.11
25 0.14
26 0.14
27 0.2
28 0.24
29 0.3
30 0.39
31 0.44
32 0.55
33 0.58
34 0.66
35 0.7
36 0.74
37 0.78
38 0.78
39 0.82
40 0.81
41 0.82
42 0.76
43 0.7
44 0.71
45 0.64
46 0.56
47 0.47
48 0.4
49 0.35
50 0.34
51 0.31
52 0.26
53 0.3
54 0.3
55 0.31
56 0.28
57 0.27
58 0.26
59 0.26
60 0.22
61 0.15
62 0.13
63 0.13
64 0.12
65 0.11
66 0.1
67 0.09
68 0.09
69 0.08
70 0.12
71 0.13
72 0.16
73 0.19
74 0.24
75 0.24
76 0.24
77 0.27
78 0.27
79 0.27
80 0.25
81 0.23
82 0.21
83 0.22
84 0.24
85 0.21
86 0.17
87 0.15
88 0.15
89 0.14
90 0.11
91 0.1
92 0.08
93 0.09
94 0.1
95 0.11
96 0.11
97 0.13
98 0.16
99 0.21
100 0.29
101 0.38
102 0.45
103 0.54
104 0.63
105 0.68
106 0.76
107 0.81
108 0.8
109 0.81
110 0.83
111 0.79
112 0.78
113 0.76
114 0.68
115 0.63
116 0.6
117 0.52
118 0.44
119 0.43
120 0.35
121 0.34
122 0.3
123 0.25
124 0.2
125 0.17
126 0.15
127 0.12
128 0.11
129 0.08
130 0.08
131 0.08
132 0.09
133 0.09
134 0.09
135 0.07
136 0.07
137 0.07
138 0.08
139 0.1
140 0.11
141 0.11
142 0.1
143 0.1
144 0.11
145 0.11
146 0.11
147 0.1
148 0.1
149 0.11
150 0.11
151 0.1
152 0.1
153 0.11
154 0.12
155 0.11
156 0.11
157 0.13
158 0.13
159 0.14
160 0.16
161 0.15
162 0.13
163 0.16
164 0.19
165 0.18
166 0.24
167 0.23
168 0.25
169 0.26
170 0.26
171 0.24
172 0.2
173 0.2
174 0.15
175 0.15
176 0.14
177 0.22
178 0.23
179 0.21
180 0.23
181 0.22
182 0.2
183 0.23
184 0.24
185 0.16
186 0.16
187 0.16
188 0.15
189 0.17
190 0.2
191 0.18
192 0.17
193 0.16
194 0.17
195 0.18
196 0.2
197 0.18
198 0.16
199 0.15
200 0.15
201 0.18
202 0.17
203 0.17
204 0.15
205 0.17
206 0.17
207 0.17
208 0.15
209 0.13
210 0.12
211 0.15
212 0.17
213 0.22
214 0.24
215 0.24
216 0.25
217 0.28
218 0.33
219 0.32
220 0.34
221 0.29
222 0.29
223 0.33
224 0.32
225 0.29
226 0.27
227 0.28
228 0.24
229 0.26
230 0.27
231 0.23
232 0.26
233 0.28
234 0.29
235 0.27
236 0.29
237 0.26
238 0.27
239 0.28
240 0.25
241 0.23
242 0.24
243 0.25
244 0.22
245 0.23
246 0.21
247 0.24
248 0.27
249 0.29
250 0.34
251 0.38
252 0.47
253 0.53
254 0.61
255 0.63
256 0.66
257 0.72
258 0.68
259 0.7
260 0.63
261 0.55
262 0.48
263 0.4
264 0.33
265 0.26
266 0.22
267 0.15
268 0.13
269 0.14
270 0.15
271 0.16
272 0.19
273 0.17
274 0.23
275 0.28
276 0.29
277 0.33
278 0.36
279 0.41
280 0.39
281 0.41