Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XTS5

Protein Details
Accession A0A0J0XTS5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-35PATSPTPLTRSKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
15-28RSKKKKWSKGKVKD
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MQNAPPATSPTPLTRSKKKKWSKGKVKDKANNAVVLDKAIYDRIMKEVPTYKIISQSVLIDRMKVNGSLARRAIAHLEKEGLIKRVVHHNAQLVYTRATTGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.65
4 0.72
5 0.78
6 0.82
7 0.85
8 0.89
9 0.9
10 0.91
11 0.93
12 0.92
13 0.92
14 0.89
15 0.85
16 0.83
17 0.74
18 0.67
19 0.56
20 0.48
21 0.38
22 0.31
23 0.23
24 0.14
25 0.12
26 0.09
27 0.08
28 0.07
29 0.07
30 0.09
31 0.1
32 0.1
33 0.12
34 0.17
35 0.18
36 0.2
37 0.21
38 0.19
39 0.23
40 0.23
41 0.21
42 0.16
43 0.17
44 0.15
45 0.18
46 0.17
47 0.14
48 0.14
49 0.15
50 0.15
51 0.13
52 0.13
53 0.12
54 0.14
55 0.17
56 0.18
57 0.17
58 0.17
59 0.17
60 0.21
61 0.21
62 0.21
63 0.18
64 0.19
65 0.19
66 0.22
67 0.23
68 0.21
69 0.19
70 0.18
71 0.19
72 0.27
73 0.31
74 0.31
75 0.32
76 0.36
77 0.36
78 0.37
79 0.38
80 0.3
81 0.29
82 0.26
83 0.25