Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XIT3

Protein Details
Accession A0A0J0XIT3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MLRKEKWQRPPRAPQPHRCPRPCAKYRRRLIGMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MLRKEKWQRPPRAPQPHRCPRPCAKYRRRLIGMTCLSAASRHAPGLYAVRAVVSTSDLCVGATSLQSVEKQLVPAMPATDLRAISIGELTAGGRPGGSKRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.91
5 0.84
6 0.82
7 0.8
8 0.82
9 0.8
10 0.8
11 0.8
12 0.8
13 0.83
14 0.85
15 0.8
16 0.73
17 0.67
18 0.66
19 0.58
20 0.49
21 0.41
22 0.31
23 0.27
24 0.23
25 0.21
26 0.13
27 0.11
28 0.09
29 0.09
30 0.09
31 0.1
32 0.12
33 0.11
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.08
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.11
63 0.1
64 0.1
65 0.12
66 0.14
67 0.13
68 0.13
69 0.13
70 0.12
71 0.11
72 0.11
73 0.09
74 0.06
75 0.07
76 0.07
77 0.07
78 0.08
79 0.07
80 0.07
81 0.09