Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XMZ5

Protein Details
Accession A0A0J0XMZ5    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPHKRAKRSVREAEKAKKGYBasic
NLS Segment(s)
PositionSequence
4-18KRAKRSVREAEKAKK
110-199AIKKAEAARGAAKKAAEDEKRARIAKAQGKVANGPEKEEKGEVKFNKPEKTFAEKERRRLNDVAQAPPSLPRLRMAEKAEKKGKKSERDP
224-232AKKEAERAK
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
Amino Acid Sequences MPHKRAKRSVREAEKAKKGYSLPPTKADDDMPRGAMRILNAGKVQAAFRAAGRKNSEDTGERKRARDDDGATERKRPKTEEGLPKIAPHESLGEYNRRIEALLRPGVSGAIKKAEAARGAAKKAAEDEKRARIAKAQGKVANGPEKEEKGEVKFNKPEKTFAEKERRRLNDVAQAPPSLPRLRMAEKAEKKGKKSERDPLNAGQRRIMEAERERVVALYRDMKAKKEAERAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.7
4 0.65
5 0.57
6 0.55
7 0.56
8 0.56
9 0.5
10 0.53
11 0.57
12 0.54
13 0.53
14 0.49
15 0.45
16 0.41
17 0.4
18 0.36
19 0.31
20 0.29
21 0.28
22 0.25
23 0.19
24 0.21
25 0.19
26 0.2
27 0.2
28 0.2
29 0.2
30 0.2
31 0.19
32 0.13
33 0.13
34 0.11
35 0.12
36 0.21
37 0.22
38 0.27
39 0.31
40 0.32
41 0.33
42 0.34
43 0.36
44 0.31
45 0.35
46 0.38
47 0.43
48 0.44
49 0.43
50 0.46
51 0.45
52 0.46
53 0.47
54 0.4
55 0.39
56 0.45
57 0.51
58 0.47
59 0.53
60 0.54
61 0.53
62 0.52
63 0.47
64 0.44
65 0.46
66 0.54
67 0.57
68 0.58
69 0.58
70 0.56
71 0.54
72 0.49
73 0.4
74 0.31
75 0.21
76 0.17
77 0.12
78 0.15
79 0.16
80 0.19
81 0.19
82 0.2
83 0.19
84 0.17
85 0.15
86 0.14
87 0.16
88 0.17
89 0.19
90 0.18
91 0.18
92 0.18
93 0.18
94 0.17
95 0.14
96 0.09
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.11
104 0.16
105 0.16
106 0.17
107 0.18
108 0.17
109 0.15
110 0.17
111 0.23
112 0.19
113 0.23
114 0.26
115 0.3
116 0.35
117 0.36
118 0.34
119 0.31
120 0.37
121 0.38
122 0.38
123 0.39
124 0.36
125 0.36
126 0.38
127 0.38
128 0.37
129 0.3
130 0.3
131 0.27
132 0.25
133 0.25
134 0.25
135 0.23
136 0.2
137 0.28
138 0.27
139 0.31
140 0.37
141 0.41
142 0.47
143 0.46
144 0.47
145 0.44
146 0.5
147 0.48
148 0.5
149 0.56
150 0.53
151 0.6
152 0.66
153 0.64
154 0.61
155 0.59
156 0.54
157 0.52
158 0.51
159 0.48
160 0.41
161 0.37
162 0.32
163 0.32
164 0.33
165 0.25
166 0.22
167 0.2
168 0.23
169 0.27
170 0.33
171 0.36
172 0.43
173 0.48
174 0.57
175 0.63
176 0.63
177 0.63
178 0.67
179 0.69
180 0.69
181 0.69
182 0.7
183 0.7
184 0.72
185 0.74
186 0.72
187 0.74
188 0.71
189 0.64
190 0.59
191 0.5
192 0.46
193 0.43
194 0.37
195 0.34
196 0.32
197 0.38
198 0.36
199 0.35
200 0.33
201 0.3
202 0.31
203 0.26
204 0.25
205 0.25
206 0.25
207 0.33
208 0.34
209 0.37
210 0.41
211 0.44
212 0.48