Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J0XIT6

Protein Details
Accession A0A0J0XIT6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-55VGTAKVNKKRTWRQYMNRRGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto_nucl 9, cyto 7, pero 5, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences DAEVDEETRALQAMMGFGGFGTTKGVEVEGNDVGTAKVNKKRTWRQYMNRRGGFNRALDSMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.06
6 0.05
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.07
13 0.06
14 0.06
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.1
23 0.12
24 0.18
25 0.22
26 0.27
27 0.36
28 0.46
29 0.54
30 0.64
31 0.7
32 0.74
33 0.81
34 0.88
35 0.89
36 0.85
37 0.8
38 0.72
39 0.69
40 0.63
41 0.55
42 0.48