Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W6Z6

Protein Details
Accession B2W6Z6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
40-67IVEPQEKKKTPKGRAKKRLTYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
46-57KKKTPKGRAKKR
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVSLPMSISRCDRRPIHQTAIVEPQEKKKTPKGRAKKRLTYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.48
4 0.47
5 0.49
6 0.53
7 0.51
8 0.47
9 0.42
10 0.38
11 0.37
12 0.35
13 0.35
14 0.34
15 0.35
16 0.36
17 0.4
18 0.38
19 0.36
20 0.4
21 0.42
22 0.43
23 0.42
24 0.4
25 0.37
26 0.42
27 0.38
28 0.34
29 0.29
30 0.31
31 0.33
32 0.34
33 0.35
34 0.36
35 0.44
36 0.52
37 0.61
38 0.66
39 0.71
40 0.8
41 0.86
42 0.87
43 0.88
44 0.89
45 0.87
46 0.85
47 0.82
48 0.8
49 0.76
50 0.69
51 0.6
52 0.56
53 0.51
54 0.45
55 0.44
56 0.38
57 0.37
58 0.37
59 0.39
60 0.38
61 0.43
62 0.49