Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1BDS2

Protein Details
Accession A0A0J1BDS2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
68-94MPPGRGQAQQPRKKRPKLGPEPKLWDVHydrophilic
233-263DLDALKPPKPPKPPRTHRPRRRYEPSPIEGFBasic
NLS Segment(s)
PositionSequence
78-85PRKKRPKL
238-254KPPKPPKPPRTHRPRRR
Subcellular Location(s) cyto 7.5, extr 6, cyto_nucl 5, E.R. 4, plas 3, mito 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGDFNADGAAKYQFVVVAIVACGVFAAGVITVMYRRRRQRILAERMGLGGFQGRTRLLLSDGVIIDMPPGRGQAQQPRKKRPKLGPEPKLWDVEVGDCVVLDALDAPEQEDSDMDSFESSIDEGTPMKGKGVNKLDVDEWQPVAINLPPHPPHNPEDPNSVPPPHPNADITLLIAMPSQSLSCPPDDGQLPLLHLPPSLCPRDADDFEDGGYSFPSVQLGSTNVRVEADWADLDALKPPKPPKPPRTHRPRRRYEPSPIEGFTRGLFRNRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.08
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.06
11 0.05
12 0.04
13 0.03
14 0.04
15 0.03
16 0.03
17 0.03
18 0.04
19 0.06
20 0.12
21 0.19
22 0.27
23 0.35
24 0.43
25 0.48
26 0.54
27 0.63
28 0.68
29 0.72
30 0.72
31 0.67
32 0.6
33 0.56
34 0.49
35 0.38
36 0.27
37 0.21
38 0.14
39 0.11
40 0.12
41 0.11
42 0.12
43 0.13
44 0.14
45 0.11
46 0.13
47 0.13
48 0.15
49 0.15
50 0.15
51 0.14
52 0.13
53 0.12
54 0.11
55 0.11
56 0.07
57 0.08
58 0.09
59 0.11
60 0.15
61 0.25
62 0.35
63 0.43
64 0.51
65 0.62
66 0.71
67 0.76
68 0.81
69 0.81
70 0.81
71 0.84
72 0.86
73 0.84
74 0.82
75 0.82
76 0.75
77 0.68
78 0.56
79 0.46
80 0.35
81 0.28
82 0.2
83 0.13
84 0.1
85 0.08
86 0.07
87 0.06
88 0.05
89 0.04
90 0.03
91 0.03
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.05
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.07
114 0.07
115 0.07
116 0.11
117 0.11
118 0.18
119 0.22
120 0.26
121 0.24
122 0.26
123 0.25
124 0.24
125 0.26
126 0.19
127 0.15
128 0.11
129 0.11
130 0.09
131 0.1
132 0.09
133 0.08
134 0.08
135 0.13
136 0.14
137 0.16
138 0.18
139 0.2
140 0.22
141 0.28
142 0.31
143 0.28
144 0.33
145 0.34
146 0.36
147 0.35
148 0.33
149 0.26
150 0.26
151 0.29
152 0.24
153 0.23
154 0.2
155 0.2
156 0.21
157 0.2
158 0.18
159 0.13
160 0.11
161 0.1
162 0.1
163 0.07
164 0.05
165 0.05
166 0.04
167 0.04
168 0.06
169 0.07
170 0.08
171 0.1
172 0.1
173 0.13
174 0.14
175 0.15
176 0.15
177 0.15
178 0.16
179 0.16
180 0.16
181 0.13
182 0.13
183 0.13
184 0.14
185 0.18
186 0.2
187 0.19
188 0.18
189 0.22
190 0.28
191 0.29
192 0.29
193 0.26
194 0.24
195 0.23
196 0.23
197 0.19
198 0.13
199 0.12
200 0.09
201 0.06
202 0.06
203 0.07
204 0.06
205 0.06
206 0.07
207 0.1
208 0.12
209 0.16
210 0.16
211 0.16
212 0.16
213 0.16
214 0.17
215 0.15
216 0.14
217 0.11
218 0.1
219 0.11
220 0.1
221 0.11
222 0.16
223 0.17
224 0.17
225 0.23
226 0.27
227 0.34
228 0.45
229 0.55
230 0.6
231 0.68
232 0.78
233 0.83
234 0.9
235 0.93
236 0.94
237 0.94
238 0.94
239 0.93
240 0.93
241 0.89
242 0.89
243 0.88
244 0.83
245 0.79
246 0.69
247 0.62
248 0.55
249 0.48
250 0.39
251 0.35
252 0.3
253 0.29