Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XUW0

Protein Details
Accession A0A0J0XUW0   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-29AAENPATATRRPRKRRRRAASYATSSSEHydrophilic
NLS Segment(s)
PositionSequence
11-19RRPRKRRRR
98-101AKAK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAAENPATATRRPRKRRRRAASYATSSSEDSDGDSGDDKAEEKMDVDEASSSGSSVSTSSEESSDSDSSESSDSSDSDSDEDSDSDADEPAAKRAAPAKAKVERPRQPTLSPSPPPRDIPSFLPAKAGEEDDRRARFKRVYMEKMVEGFGGDLETLRASDPTLGPSRLQLLIDSLAAGVDVFAEPNSGKSVDEVGVILNEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.93
4 0.93
5 0.93
6 0.93
7 0.92
8 0.91
9 0.88
10 0.81
11 0.73
12 0.65
13 0.55
14 0.46
15 0.36
16 0.26
17 0.19
18 0.15
19 0.12
20 0.1
21 0.11
22 0.1
23 0.09
24 0.1
25 0.09
26 0.09
27 0.1
28 0.09
29 0.09
30 0.09
31 0.1
32 0.1
33 0.09
34 0.09
35 0.08
36 0.09
37 0.08
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.08
46 0.08
47 0.09
48 0.09
49 0.1
50 0.13
51 0.12
52 0.12
53 0.11
54 0.11
55 0.11
56 0.11
57 0.1
58 0.08
59 0.08
60 0.08
61 0.09
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.05
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.12
82 0.17
83 0.18
84 0.2
85 0.26
86 0.31
87 0.38
88 0.45
89 0.5
90 0.52
91 0.55
92 0.58
93 0.55
94 0.5
95 0.49
96 0.48
97 0.46
98 0.45
99 0.44
100 0.44
101 0.44
102 0.45
103 0.43
104 0.4
105 0.35
106 0.33
107 0.32
108 0.29
109 0.27
110 0.27
111 0.23
112 0.22
113 0.21
114 0.19
115 0.17
116 0.17
117 0.21
118 0.24
119 0.27
120 0.28
121 0.29
122 0.31
123 0.31
124 0.33
125 0.39
126 0.42
127 0.46
128 0.48
129 0.5
130 0.48
131 0.46
132 0.42
133 0.32
134 0.23
135 0.17
136 0.12
137 0.08
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.08
147 0.09
148 0.13
149 0.17
150 0.18
151 0.18
152 0.19
153 0.22
154 0.21
155 0.21
156 0.17
157 0.15
158 0.15
159 0.15
160 0.13
161 0.1
162 0.08
163 0.08
164 0.07
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.06
171 0.06
172 0.08
173 0.1
174 0.1
175 0.1
176 0.11
177 0.14
178 0.13
179 0.14
180 0.13
181 0.11
182 0.11