Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XIK6

Protein Details
Accession A0A0J0XIK6   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-95QLNNPTPTPWRPRRRRLAPRRIGHDESHydrophilic
NLS Segment(s)
PositionSequence
79-89RPRRRRLAPRR
Subcellular Location(s) mito 15, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MAGWLCLQNRFCRHESQRTTGAKDRDEGRKPSCPLGGYIQLPCCLPVPPTEPYKTGIIRYPSDASRHYQLNNPTPTPWRPRRRRLAPRRIGHDESGEPGGVRERHCRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.6
4 0.63
5 0.62
6 0.66
7 0.63
8 0.6
9 0.51
10 0.49
11 0.48
12 0.48
13 0.5
14 0.49
15 0.47
16 0.5
17 0.51
18 0.5
19 0.47
20 0.39
21 0.35
22 0.34
23 0.33
24 0.27
25 0.27
26 0.25
27 0.23
28 0.22
29 0.21
30 0.17
31 0.12
32 0.11
33 0.11
34 0.13
35 0.15
36 0.19
37 0.2
38 0.2
39 0.22
40 0.25
41 0.23
42 0.21
43 0.22
44 0.22
45 0.21
46 0.23
47 0.23
48 0.21
49 0.23
50 0.23
51 0.22
52 0.22
53 0.24
54 0.22
55 0.25
56 0.29
57 0.35
58 0.38
59 0.36
60 0.34
61 0.37
62 0.41
63 0.45
64 0.5
65 0.52
66 0.58
67 0.67
68 0.76
69 0.82
70 0.89
71 0.9
72 0.91
73 0.91
74 0.9
75 0.88
76 0.86
77 0.79
78 0.7
79 0.64
80 0.54
81 0.47
82 0.4
83 0.32
84 0.24
85 0.2
86 0.24
87 0.22
88 0.24