FuNGI

A0A0J1AYR9

Protein Details

Accession

A0A0J1AYR9

Localization Confidence

Low

Confidence Score

8.8

NoLS Segment(s)

Position	Sequence	Protein Nature
25-51	EAVRRAHRLAKNKVENERRRRRSCGEG	Basic

NLS Segment(s)

Position	Sequence
31-45	HRLAKNKVENERRRR

Subcellular Location(s)

mito 14, cyto 10, nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR000924 Glu/Gln-tRNA-synth IPR020058 Glu/Gln-tRNA-synth_Ib_cat-dom IPR020059 Glu/Gln-tRNA-synth_Ib_codon-bd IPR011035 Ribosomal_L25/Gln-tRNA_synth IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0005737 C:cytoplasm GO:0004812 F:aminoacyl-tRNA ligase activity GO:0005524 F:ATP binding GO:0016740 F:transferase activity GO:0006418 P:tRNA aminoacylation for protein translation
Pfam	View protein in Pfam PF00749 tRNA-synt_1c PF03950 tRNA-synt_1c_C

Amino Acid Sequences

MIFNDPRRTHLLRWFKYLDAQPALEAVRRAHRLAKNKVENERRRRRSCGEGLDAILPAVEEGGVVVRFECSTSSFLHVGQLKELLVNRYFADKHSGHLLLRFNDLRPLSEAGDFVNDIIADLGAIGLSFDRISRVTDHLDAMRHYARQLIQTGNAYMDDAPDDIAEEMKLPLTPSPRRDTRIEVNLERFEAMLMGTGSVEGRWVVRARIDSAPDAEALRDPIILFQSAISGNHSSSSVWPTHYFAGPIVDHCDGVTHVIRTIDSAASKQLYMWFVEQLGLRPPVISYLPRLDIECGPSSHKEVEHLAHEGLIRGWDDPRVGSVRGILARGMTPAALKKHVLDKSEVIIDTTLSWDELWYANRRAIDTVVPRYWAISDIGASVVAKVEGINRIFTSSKPLNKLNAEVGTKLMVYTTHIFLEQVDVLSLVEGEEITLMDFTTAVVRSLIKAPSPQGTVVKSLTLALNPHGNPKLTSKRFHWLPAAAPTAVLGGALTPVVLVKYPRPNYIGQCEVRTPALASPQVGQMRKGDILQFERKGFYVCHGTAPEGGLEFVAIPEGRSPRRRSTVLS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.54
3	0.57
4	0.57
5	0.55
6	0.48
7	0.45
8	0.37
9	0.36
10	0.36
11	0.31
12	0.27
13	0.23
14	0.26
15	0.29
16	0.31
17	0.37
18	0.43
19	0.5
20	0.58
21	0.66
22	0.67
23	0.71
24	0.8
25	0.82
26	0.85
27	0.87
28	0.88
29	0.88
30	0.84
31	0.85
32	0.81
33	0.8
34	0.78
35	0.76
36	0.72
37	0.65
38	0.6
39	0.54
40	0.48
41	0.38
42	0.28
43	0.19
44	0.11
45	0.08
46	0.05
47	0.03
48	0.03
49	0.06
50	0.06
51	0.06
52	0.06
53	0.07
54	0.07
55	0.08
56	0.09
57	0.09
58	0.11
59	0.13
60	0.17
61	0.17
62	0.17
63	0.23
64	0.27
65	0.25
66	0.25
67	0.24
68	0.2
69	0.22
70	0.24
71	0.22
72	0.19
73	0.2
74	0.19
75	0.23
76	0.23
77	0.21
78	0.27
79	0.23
80	0.24
81	0.28
82	0.3
83	0.25
84	0.3
85	0.33
86	0.27
87	0.34
88	0.33
89	0.28
90	0.32
91	0.32
92	0.29
93	0.27
94	0.28
95	0.23
96	0.23
97	0.22
98	0.16
99	0.18
100	0.16
101	0.13
102	0.11
103	0.09
104	0.08
105	0.08
106	0.07
107	0.04
108	0.04
109	0.04
110	0.03
111	0.03
112	0.03
113	0.02
114	0.03
115	0.03
116	0.04
117	0.05
118	0.06
119	0.08
120	0.11
121	0.14
122	0.16
123	0.18
124	0.2
125	0.21
126	0.23
127	0.22
128	0.24
129	0.23
130	0.21
131	0.19
132	0.21
133	0.2
134	0.22
135	0.24
136	0.21
137	0.22
138	0.23
139	0.24
140	0.2
141	0.19
142	0.16
143	0.13
144	0.11
145	0.09
146	0.07
147	0.07
148	0.06
149	0.06
150	0.06
151	0.06
152	0.06
153	0.06
154	0.06
155	0.06
156	0.07
157	0.07
158	0.09
159	0.15
160	0.2
161	0.24
162	0.31
163	0.36
164	0.39
165	0.42
166	0.45
167	0.47
168	0.5
169	0.52
170	0.48
171	0.48
172	0.46
173	0.43
174	0.37
175	0.29
176	0.21
177	0.15
178	0.11
179	0.07
180	0.06
181	0.05
182	0.05
183	0.05
184	0.05
185	0.05
186	0.05
187	0.04
188	0.04
189	0.06
190	0.07
191	0.08
192	0.1
193	0.12
194	0.15
195	0.18
196	0.19
197	0.18
198	0.19
199	0.19
200	0.17
201	0.16
202	0.13
203	0.1
204	0.1
205	0.09
206	0.08
207	0.07
208	0.08
209	0.08
210	0.08
211	0.08
212	0.06
213	0.08
214	0.08
215	0.08
216	0.09
217	0.09
218	0.09
219	0.1
220	0.1
221	0.09
222	0.1
223	0.12
224	0.11
225	0.12
226	0.13
227	0.14
228	0.16
229	0.16
230	0.15
231	0.12
232	0.14
233	0.13
234	0.12
235	0.14
236	0.12
237	0.12
238	0.11
239	0.11
240	0.08
241	0.1
242	0.11
243	0.08
244	0.08
245	0.09
246	0.09
247	0.09
248	0.1
249	0.09
250	0.08
251	0.08
252	0.09
253	0.09
254	0.09
255	0.09
256	0.1
257	0.1
258	0.11
259	0.11
260	0.1
261	0.1
262	0.11
263	0.11
264	0.09
265	0.11
266	0.11
267	0.1
268	0.1
269	0.1
270	0.09
271	0.1
272	0.1
273	0.09
274	0.11
275	0.13
276	0.13
277	0.14
278	0.14
279	0.14
280	0.17
281	0.16
282	0.14
283	0.15
284	0.15
285	0.17
286	0.17
287	0.16
288	0.14
289	0.15
290	0.15
291	0.15
292	0.15
293	0.13
294	0.13
295	0.13
296	0.12
297	0.1
298	0.09
299	0.08
300	0.07
301	0.07
302	0.07
303	0.07
304	0.07
305	0.09
306	0.1
307	0.1
308	0.1
309	0.1
310	0.12
311	0.12
312	0.13
313	0.11
314	0.09
315	0.09
316	0.09
317	0.09
318	0.06
319	0.06
320	0.09
321	0.11
322	0.12
323	0.12
324	0.13
325	0.2
326	0.23
327	0.24
328	0.24
329	0.23
330	0.24
331	0.26
332	0.25
333	0.18
334	0.15
335	0.13
336	0.11
337	0.1
338	0.08
339	0.06
340	0.06
341	0.05
342	0.06
343	0.08
344	0.1
345	0.13
346	0.14
347	0.16
348	0.17
349	0.18
350	0.18
351	0.17
352	0.2
353	0.2
354	0.25
355	0.24
356	0.24
357	0.23
358	0.23
359	0.22
360	0.19
361	0.15
362	0.09
363	0.09
364	0.08
365	0.08
366	0.08
367	0.07
368	0.06
369	0.06
370	0.05
371	0.05
372	0.04
373	0.06
374	0.1
375	0.11
376	0.12
377	0.12
378	0.14
379	0.15
380	0.15
381	0.22
382	0.23
383	0.28
384	0.31
385	0.34
386	0.37
387	0.38
388	0.4
389	0.37
390	0.37
391	0.33
392	0.28
393	0.26
394	0.22
395	0.2
396	0.17
397	0.13
398	0.08
399	0.1
400	0.12
401	0.13
402	0.12
403	0.12
404	0.13
405	0.12
406	0.15
407	0.12
408	0.1
409	0.08
410	0.08
411	0.08
412	0.08
413	0.07
414	0.05
415	0.04
416	0.03
417	0.03
418	0.03
419	0.03
420	0.04
421	0.04
422	0.04
423	0.04
424	0.04
425	0.04
426	0.06
427	0.07
428	0.07
429	0.08
430	0.08
431	0.1
432	0.14
433	0.16
434	0.14
435	0.17
436	0.18
437	0.22
438	0.24
439	0.25
440	0.24
441	0.25
442	0.27
443	0.25
444	0.23
445	0.19
446	0.19
447	0.17
448	0.15
449	0.15
450	0.13
451	0.19
452	0.19
453	0.25
454	0.26
455	0.27
456	0.27
457	0.34
458	0.43
459	0.41
460	0.46
461	0.44
462	0.51
463	0.53
464	0.56
465	0.54
466	0.46
467	0.45
468	0.46
469	0.46
470	0.36
471	0.33
472	0.28
473	0.23
474	0.2
475	0.15
476	0.08
477	0.04
478	0.04
479	0.04
480	0.04
481	0.03
482	0.04
483	0.04
484	0.06
485	0.07
486	0.13
487	0.24
488	0.27
489	0.31
490	0.34
491	0.38
492	0.43
493	0.49
494	0.52
495	0.45
496	0.46
497	0.44
498	0.43
499	0.4
500	0.35
501	0.29
502	0.22
503	0.26
504	0.24
505	0.23
506	0.22
507	0.29
508	0.34
509	0.34
510	0.33
511	0.29
512	0.31
513	0.32
514	0.32
515	0.28
516	0.28
517	0.34
518	0.4
519	0.42
520	0.4
521	0.41
522	0.4
523	0.38
524	0.33
525	0.31
526	0.31
527	0.27
528	0.31
529	0.3
530	0.32
531	0.31
532	0.31
533	0.27
534	0.19
535	0.19
536	0.13
537	0.11
538	0.1
539	0.08
540	0.1
541	0.08
542	0.08
543	0.13
544	0.2
545	0.27
546	0.35
547	0.41
548	0.48
549	0.56

A0A0J1AYR9

3D AlphaFold-predicted Structure Viewer