Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XSY5

Protein Details
Accession A0A0J0XSY5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-49RLFSRKPKAPKAAKPPKAPKPPKARRRRGSGGGBasic
NLS Segment(s)
PositionSequence
20-50SRKPKAPKAAKPPKAPKPPKARRRRGSGGGG
Subcellular Location(s) mito 16.5, mito_nucl 12, nucl 6.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MNNTNTPIMTQRNWLARLFSRKPKAPKAAKPPKAPKPPKARRRRGSGGGGGSGGGDGGGGGDGGGGGGGGGGDGGGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.37
4 0.45
5 0.46
6 0.5
7 0.51
8 0.56
9 0.63
10 0.67
11 0.71
12 0.7
13 0.73
14 0.75
15 0.78
16 0.79
17 0.82
18 0.82
19 0.82
20 0.84
21 0.82
22 0.79
23 0.79
24 0.82
25 0.82
26 0.84
27 0.85
28 0.8
29 0.83
30 0.82
31 0.77
32 0.72
33 0.67
34 0.58
35 0.48
36 0.41
37 0.32
38 0.25
39 0.18
40 0.11
41 0.06
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02