Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XX45

Protein Details
Accession A0A0J0XX45   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-71EAPGGSLKRPRKKQGLSKGYVHydrophilic
NLS Segment(s)
PositionSequence
59-62RPRK
152-158KRARKKA
184-211PPKARTPFSVPRKPGQKPPFPRASAPPG
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, mito 7, nucl 5.5, extr 3
Family & Domain DBs
Amino Acid Sequences MGLLCSPANSLALPEKHLHASHDLISLLHLDGLYNSYVRPYFDPVPETDDEAPGGSLKRPRKKQGLSKGYVGLLEDCIDPVPLGPSAQPSLGPLVKDFTDPGNHAWQPEENAMGPLQILPPEAFASARLEVGVKVEGYAQGVKLGVKEAEEKRARKKARMSQSVAPDLPDLPGTPGPGVPNPPPPKARTPFSVPRKPGQKPPFPRASAPPGQSGFRPGTPGTPTPRPVGRAPGTPNGNKRPGDGAYPAATKKRAVGTGSRSASPMGAASSAGNDVSVRGVFKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.3
5 0.3
6 0.26
7 0.28
8 0.27
9 0.28
10 0.25
11 0.21
12 0.2
13 0.19
14 0.15
15 0.13
16 0.1
17 0.07
18 0.08
19 0.09
20 0.1
21 0.08
22 0.08
23 0.1
24 0.11
25 0.13
26 0.15
27 0.2
28 0.23
29 0.26
30 0.29
31 0.27
32 0.32
33 0.31
34 0.33
35 0.28
36 0.24
37 0.22
38 0.19
39 0.18
40 0.14
41 0.14
42 0.13
43 0.19
44 0.27
45 0.37
46 0.44
47 0.52
48 0.61
49 0.69
50 0.76
51 0.8
52 0.82
53 0.76
54 0.73
55 0.67
56 0.58
57 0.49
58 0.4
59 0.29
60 0.19
61 0.16
62 0.12
63 0.09
64 0.08
65 0.08
66 0.07
67 0.06
68 0.07
69 0.06
70 0.07
71 0.07
72 0.09
73 0.1
74 0.1
75 0.1
76 0.09
77 0.13
78 0.14
79 0.14
80 0.12
81 0.13
82 0.13
83 0.14
84 0.14
85 0.12
86 0.13
87 0.14
88 0.16
89 0.2
90 0.2
91 0.2
92 0.2
93 0.2
94 0.19
95 0.19
96 0.18
97 0.11
98 0.12
99 0.11
100 0.1
101 0.09
102 0.07
103 0.06
104 0.05
105 0.06
106 0.05
107 0.06
108 0.06
109 0.07
110 0.06
111 0.07
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.07
118 0.08
119 0.08
120 0.06
121 0.05
122 0.06
123 0.06
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.06
133 0.06
134 0.12
135 0.12
136 0.21
137 0.26
138 0.29
139 0.35
140 0.44
141 0.45
142 0.45
143 0.53
144 0.53
145 0.58
146 0.64
147 0.63
148 0.6
149 0.63
150 0.62
151 0.54
152 0.45
153 0.35
154 0.27
155 0.22
156 0.17
157 0.11
158 0.09
159 0.09
160 0.09
161 0.09
162 0.1
163 0.1
164 0.11
165 0.14
166 0.14
167 0.23
168 0.26
169 0.3
170 0.32
171 0.35
172 0.42
173 0.44
174 0.46
175 0.41
176 0.45
177 0.51
178 0.58
179 0.63
180 0.58
181 0.6
182 0.65
183 0.64
184 0.66
185 0.65
186 0.65
187 0.64
188 0.69
189 0.71
190 0.65
191 0.65
192 0.61
193 0.6
194 0.57
195 0.51
196 0.49
197 0.41
198 0.4
199 0.37
200 0.35
201 0.3
202 0.24
203 0.25
204 0.19
205 0.21
206 0.24
207 0.28
208 0.31
209 0.34
210 0.36
211 0.37
212 0.4
213 0.4
214 0.38
215 0.42
216 0.39
217 0.39
218 0.42
219 0.46
220 0.49
221 0.51
222 0.57
223 0.56
224 0.59
225 0.53
226 0.51
227 0.47
228 0.43
229 0.41
230 0.36
231 0.32
232 0.29
233 0.32
234 0.32
235 0.31
236 0.31
237 0.28
238 0.3
239 0.31
240 0.31
241 0.3
242 0.36
243 0.38
244 0.46
245 0.49
246 0.46
247 0.41
248 0.38
249 0.35
250 0.28
251 0.22
252 0.13
253 0.11
254 0.1
255 0.09
256 0.1
257 0.11
258 0.1
259 0.09
260 0.08
261 0.08
262 0.1
263 0.11