Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J1B860

Protein Details
Accession A0A0J1B860    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-84NTTCIEELRKPRRKAKRQNPSATVIHydrophilic
NLS Segment(s)
PositionSequence
68-76RKPRRKAKR
Subcellular Location(s) extr 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011058  Cyanovirin-N  
IPR036673  Cyanovirin-N_sf  
Pfam View protein in Pfam  
PF08881  CVNH  
Amino Acid Sequences MRYFPVLVLLLAFVTLASGRPRGPTPAAPLRLARSNREALVNNLPLPRPASIPMRCDRSNTTCIEELRKPRRKAKRQNPSATVIPALTANYQQTCNSVRLSSTTNPTLQANCKTQTGAYNPGASFRLSQCVSFGAQGLQCNWRPAVNLFQNFCSNCRLEGTVLVCECGTLFVNTHRTDLSACVANEDGELACRTTRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.08
5 0.1
6 0.11
7 0.14
8 0.16
9 0.21
10 0.24
11 0.26
12 0.33
13 0.4
14 0.43
15 0.42
16 0.43
17 0.43
18 0.47
19 0.46
20 0.42
21 0.38
22 0.39
23 0.38
24 0.4
25 0.37
26 0.33
27 0.39
28 0.36
29 0.33
30 0.32
31 0.31
32 0.27
33 0.28
34 0.24
35 0.18
36 0.19
37 0.24
38 0.25
39 0.3
40 0.34
41 0.39
42 0.38
43 0.4
44 0.42
45 0.4
46 0.41
47 0.38
48 0.37
49 0.34
50 0.35
51 0.37
52 0.37
53 0.41
54 0.48
55 0.55
56 0.56
57 0.61
58 0.71
59 0.76
60 0.82
61 0.83
62 0.84
63 0.85
64 0.89
65 0.83
66 0.78
67 0.69
68 0.59
69 0.48
70 0.37
71 0.27
72 0.18
73 0.14
74 0.1
75 0.08
76 0.08
77 0.08
78 0.09
79 0.09
80 0.11
81 0.12
82 0.13
83 0.13
84 0.12
85 0.11
86 0.12
87 0.16
88 0.16
89 0.18
90 0.18
91 0.18
92 0.19
93 0.19
94 0.2
95 0.19
96 0.22
97 0.21
98 0.21
99 0.21
100 0.2
101 0.2
102 0.22
103 0.22
104 0.24
105 0.22
106 0.24
107 0.23
108 0.25
109 0.25
110 0.21
111 0.2
112 0.14
113 0.19
114 0.16
115 0.16
116 0.15
117 0.15
118 0.15
119 0.14
120 0.14
121 0.1
122 0.11
123 0.12
124 0.13
125 0.17
126 0.18
127 0.19
128 0.19
129 0.18
130 0.18
131 0.19
132 0.26
133 0.29
134 0.33
135 0.33
136 0.35
137 0.4
138 0.38
139 0.38
140 0.33
141 0.27
142 0.22
143 0.23
144 0.22
145 0.17
146 0.21
147 0.22
148 0.22
149 0.21
150 0.21
151 0.18
152 0.17
153 0.16
154 0.13
155 0.12
156 0.08
157 0.1
158 0.14
159 0.21
160 0.22
161 0.23
162 0.22
163 0.22
164 0.22
165 0.23
166 0.22
167 0.21
168 0.2
169 0.21
170 0.22
171 0.21
172 0.2
173 0.19
174 0.15
175 0.11
176 0.13
177 0.11
178 0.11