Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W2Z4

Protein Details
Accession B2W2Z4   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
163-183EGQGTAASKPKRKKPWEKDGAHydrophilic
NLS Segment(s)
PositionSequence
171-180KPKRKKPWEK
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 11.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSVAEDGLSDLYEALERYNWDDDIEFQAGLQAIIGSNSTPEQTTELALRARCFYYARKYNKTIDFDAYKAYRSARNRPPPTPPSSTNVLASSIVDDVIPDPASAATTAPASAPVPEPSGIMPSPTSPSEPPAPYPTSFAHIVELITSGKPVPGIKEIPPTVLEGQGTAASKPKRKKPWEKDGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.1
4 0.13
5 0.16
6 0.16
7 0.16
8 0.16
9 0.17
10 0.2
11 0.21
12 0.17
13 0.14
14 0.16
15 0.15
16 0.14
17 0.12
18 0.07
19 0.05
20 0.06
21 0.07
22 0.04
23 0.05
24 0.06
25 0.07
26 0.07
27 0.07
28 0.09
29 0.1
30 0.11
31 0.11
32 0.13
33 0.16
34 0.17
35 0.17
36 0.17
37 0.17
38 0.17
39 0.18
40 0.2
41 0.27
42 0.35
43 0.42
44 0.46
45 0.5
46 0.56
47 0.61
48 0.61
49 0.54
50 0.5
51 0.44
52 0.38
53 0.39
54 0.32
55 0.26
56 0.22
57 0.21
58 0.22
59 0.24
60 0.33
61 0.38
62 0.48
63 0.52
64 0.54
65 0.61
66 0.6
67 0.62
68 0.58
69 0.51
70 0.44
71 0.44
72 0.42
73 0.35
74 0.3
75 0.25
76 0.19
77 0.17
78 0.13
79 0.09
80 0.07
81 0.06
82 0.05
83 0.04
84 0.05
85 0.05
86 0.04
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.05
95 0.05
96 0.06
97 0.05
98 0.06
99 0.08
100 0.08
101 0.1
102 0.1
103 0.1
104 0.1
105 0.12
106 0.11
107 0.11
108 0.1
109 0.1
110 0.12
111 0.13
112 0.15
113 0.13
114 0.16
115 0.21
116 0.22
117 0.24
118 0.26
119 0.29
120 0.27
121 0.3
122 0.27
123 0.26
124 0.26
125 0.23
126 0.2
127 0.17
128 0.16
129 0.13
130 0.14
131 0.11
132 0.09
133 0.09
134 0.08
135 0.08
136 0.09
137 0.1
138 0.11
139 0.15
140 0.18
141 0.2
142 0.29
143 0.29
144 0.3
145 0.3
146 0.31
147 0.27
148 0.27
149 0.24
150 0.15
151 0.16
152 0.17
153 0.18
154 0.14
155 0.2
156 0.24
157 0.32
158 0.4
159 0.49
160 0.57
161 0.67
162 0.78
163 0.81