Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J0XZ27

Protein Details
Accession A0A0J0XZ27   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSAKKPQAKRTKETLSTHydrophilic
79-98EAQKKQPKKFKAPKAPSPLPHydrophilic
NLS Segment(s)
PositionSequence
3-14KRKSAKKPQAKR
83-92KQPKKFKAPK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSAKKPQAKRTKETLSTSFKCLFCHHDNSVTVKIDKAAMFGHLSCKVCGQKFTTPVNNLSAAVDVYCDWVDACEEAQKKQPKKFKAPKAPSPLPAVSAALNDEDDDDDDLDLASALDKAKRKPTSRDYDEDSDDDRHRRKQARRAYDEDDDDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.8
4 0.76
5 0.73
6 0.71
7 0.67
8 0.65
9 0.62
10 0.53
11 0.48
12 0.44
13 0.43
14 0.38
15 0.42
16 0.4
17 0.39
18 0.4
19 0.43
20 0.46
21 0.41
22 0.36
23 0.3
24 0.28
25 0.25
26 0.22
27 0.19
28 0.14
29 0.12
30 0.13
31 0.13
32 0.16
33 0.18
34 0.19
35 0.18
36 0.22
37 0.25
38 0.24
39 0.26
40 0.27
41 0.27
42 0.32
43 0.37
44 0.39
45 0.38
46 0.38
47 0.38
48 0.34
49 0.29
50 0.24
51 0.19
52 0.12
53 0.1
54 0.08
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.08
65 0.09
66 0.1
67 0.17
68 0.25
69 0.29
70 0.35
71 0.42
72 0.44
73 0.55
74 0.64
75 0.67
76 0.71
77 0.75
78 0.77
79 0.8
80 0.78
81 0.69
82 0.65
83 0.55
84 0.45
85 0.38
86 0.3
87 0.21
88 0.17
89 0.15
90 0.09
91 0.09
92 0.07
93 0.07
94 0.06
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.05
107 0.09
108 0.13
109 0.16
110 0.25
111 0.33
112 0.38
113 0.46
114 0.55
115 0.62
116 0.66
117 0.68
118 0.67
119 0.65
120 0.64
121 0.57
122 0.5
123 0.45
124 0.42
125 0.43
126 0.41
127 0.42
128 0.47
129 0.54
130 0.59
131 0.64
132 0.71
133 0.74
134 0.78
135 0.78
136 0.77
137 0.75
138 0.71
139 0.65