FuNGI

A0A0J1B9F8

Protein Details

Accession

A0A0J1B9F8

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
56-82	SIAAVKYRDRPKLKTKKVKWEWTEFTP	Hydrophilic

NLS Segment(s)

Position	Sequence
294-298	KKKRR

Subcellular Location(s)

mito 14, nucl 8.5, cyto_nucl 6.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR032563 DAMP1_SANT-like IPR027109 Swc4/Dmap1
Gene Ontology	GO:0035267 C:NuA4 histone acetyltransferase complex GO:0005634 C:nucleus GO:0006338 P:chromatin remodeling GO:0006281 P:DNA repair GO:0043968 P:histone H2A acetylation GO:0043967 P:histone H4 acetylation
Pfam	View protein in Pfam PF16282 SANT_DAMP1_like

Amino Acid Sequences

MTSQDVRSILNLPASGSAPTTSSRKATGPRKPDGISRELYALIGDNAPSLAEAQASIAAVKYRDRPKLKTKKVKWEWTEFTPMAREGEPGAPRLGHWVRVTDEDPHARNEYFGGFNLHGPSVMEYSQYEYDQHLVDPGWSAHETSYLFDLLREYDLRFVVAADRYVYTGAKGNEPPKKRSIEEMKDRYYTICRRLIRTRTASDPAVQQQLITQYTFDKAREIKRKQYASELFHLTAAEIAEEEALYLEVKRLEQNERRYRADRDSLMRSVIGLDSGLVSLEQKNAEGVHGLGNKKKRRPEEDSGVASPAPPTKKQKDQAAYDAANCIYRVPAPTPAPNSSHLATKHPAHVPVYLRSTKMPLPKPNTAIRVTELLAEMGVSTARLVMPTRTNLEAYDGVLQAAASLVDMKRQVDRVEQEIRTLKAQRDGGYVPPVDVSRKRSESVLSTDTSTTNRRSRAP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.19
3	0.17
4	0.16
5	0.14
6	0.16
7	0.19
8	0.2
9	0.21
10	0.24
11	0.28
12	0.37
13	0.45
14	0.51
15	0.56
16	0.59
17	0.63
18	0.63
19	0.64
20	0.61
21	0.57
22	0.51
23	0.45
24	0.4
25	0.34
26	0.31
27	0.25
28	0.2
29	0.15
30	0.13
31	0.11
32	0.09
33	0.09
34	0.09
35	0.08
36	0.08
37	0.07
38	0.06
39	0.06
40	0.06
41	0.07
42	0.08
43	0.07
44	0.07
45	0.09
46	0.1
47	0.13
48	0.21
49	0.27
50	0.37
51	0.43
52	0.49
53	0.59
54	0.69
55	0.77
56	0.8
57	0.82
58	0.84
59	0.88
60	0.92
61	0.87
62	0.86
63	0.81
64	0.75
65	0.74
66	0.63
67	0.55
68	0.47
69	0.41
70	0.34
71	0.28
72	0.24
73	0.17
74	0.23
75	0.23
76	0.21
77	0.21
78	0.19
79	0.18
80	0.26
81	0.25
82	0.24
83	0.24
84	0.25
85	0.26
86	0.3
87	0.31
88	0.27
89	0.31
90	0.32
91	0.32
92	0.33
93	0.34
94	0.3
95	0.29
96	0.25
97	0.23
98	0.18
99	0.17
100	0.18
101	0.16
102	0.17
103	0.19
104	0.18
105	0.15
106	0.14
107	0.15
108	0.12
109	0.12
110	0.11
111	0.09
112	0.13
113	0.15
114	0.15
115	0.14
116	0.13
117	0.15
118	0.14
119	0.14
120	0.12
121	0.1
122	0.1
123	0.1
124	0.1
125	0.11
126	0.11
127	0.11
128	0.1
129	0.12
130	0.13
131	0.12
132	0.13
133	0.11
134	0.11
135	0.1
136	0.11
137	0.09
138	0.11
139	0.11
140	0.1
141	0.12
142	0.12
143	0.12
144	0.11
145	0.1
146	0.11
147	0.11
148	0.11
149	0.1
150	0.1
151	0.1
152	0.11
153	0.11
154	0.09
155	0.13
156	0.13
157	0.16
158	0.19
159	0.25
160	0.32
161	0.36
162	0.39
163	0.41
164	0.44
165	0.41
166	0.46
167	0.5
168	0.52
169	0.58
170	0.61
171	0.59
172	0.56
173	0.56
174	0.48
175	0.45
176	0.4
177	0.36
178	0.36
179	0.34
180	0.38
181	0.45
182	0.49
183	0.5
184	0.51
185	0.48
186	0.46
187	0.48
188	0.43
189	0.37
190	0.34
191	0.29
192	0.27
193	0.24
194	0.19
195	0.16
196	0.18
197	0.18
198	0.14
199	0.12
200	0.1
201	0.12
202	0.13
203	0.12
204	0.12
205	0.15
206	0.23
207	0.33
208	0.36
209	0.43
210	0.5
211	0.53
212	0.5
213	0.56
214	0.53
215	0.47
216	0.48
217	0.42
218	0.34
219	0.32
220	0.31
221	0.21
222	0.16
223	0.12
224	0.08
225	0.05
226	0.04
227	0.04
228	0.04
229	0.04
230	0.03
231	0.03
232	0.03
233	0.03
234	0.04
235	0.05
236	0.05
237	0.07
238	0.09
239	0.16
240	0.23
241	0.33
242	0.41
243	0.46
244	0.5
245	0.52
246	0.53
247	0.51
248	0.51
249	0.45
250	0.41
251	0.41
252	0.37
253	0.35
254	0.31
255	0.25
256	0.2
257	0.16
258	0.11
259	0.06
260	0.05
261	0.05
262	0.05
263	0.04
264	0.03
265	0.04
266	0.05
267	0.06
268	0.07
269	0.06
270	0.07
271	0.07
272	0.07
273	0.07
274	0.07
275	0.1
276	0.15
277	0.16
278	0.2
279	0.28
280	0.34
281	0.4
282	0.46
283	0.49
284	0.53
285	0.6
286	0.64
287	0.65
288	0.66
289	0.66
290	0.6
291	0.54
292	0.46
293	0.37
294	0.3
295	0.25
296	0.2
297	0.2
298	0.27
299	0.32
300	0.41
301	0.47
302	0.55
303	0.58
304	0.6
305	0.61
306	0.6
307	0.55
308	0.47
309	0.43
310	0.34
311	0.28
312	0.23
313	0.17
314	0.11
315	0.11
316	0.12
317	0.12
318	0.18
319	0.2
320	0.25
321	0.3
322	0.32
323	0.33
324	0.33
325	0.36
326	0.3
327	0.33
328	0.29
329	0.29
330	0.3
331	0.31
332	0.34
333	0.33
334	0.35
335	0.31
336	0.35
337	0.34
338	0.35
339	0.39
340	0.35
341	0.34
342	0.32
343	0.34
344	0.34
345	0.39
346	0.42
347	0.44
348	0.49
349	0.54
350	0.58
351	0.61
352	0.62
353	0.56
354	0.5
355	0.43
356	0.39
357	0.33
358	0.29
359	0.23
360	0.18
361	0.15
362	0.13
363	0.1
364	0.07
365	0.07
366	0.04
367	0.04
368	0.05
369	0.05
370	0.06
371	0.07
372	0.11
373	0.15
374	0.19
375	0.22
376	0.23
377	0.24
378	0.23
379	0.27
380	0.24
381	0.22
382	0.22
383	0.18
384	0.16
385	0.16
386	0.15
387	0.1
388	0.1
389	0.08
390	0.04
391	0.07
392	0.07
393	0.1
394	0.12
395	0.14
396	0.17
397	0.2
398	0.21
399	0.26
400	0.3
401	0.33
402	0.4
403	0.39
404	0.42
405	0.45
406	0.45
407	0.43
408	0.45
409	0.42
410	0.41
411	0.44
412	0.4
413	0.4
414	0.4
415	0.38
416	0.4
417	0.37
418	0.3
419	0.29
420	0.28
421	0.29
422	0.32
423	0.34
424	0.37
425	0.4
426	0.41
427	0.41
428	0.44
429	0.43
430	0.46
431	0.43
432	0.36
433	0.35
434	0.35
435	0.35
436	0.34
437	0.34
438	0.34
439	0.37

A0A0J1B9F8

3D AlphaFold-predicted Structure Viewer