Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BD45

Protein Details
Accession A0A0H1BD45    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-56HVVARRRKAERERERKKERERRRVEGEEBasic
81-102REKSAPVRRDEKRGKRVRQVEVBasic
NLS Segment(s)
PositionSequence
33-98RRRKAERERERKKERERRRVEGEERDRLRIEKRYEREEVVREKLARRCREKSAPVRRDEKRGKRVR
Subcellular Location(s) cyto 18.5, cyto_nucl 12, nucl 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences RLRAEAEGVAVAAAAGHRDGDGNFNADGHVVARRRKAERERERKKERERRRVEGEERDRLRIEKRYEREEVVREKLARRCREKSAPVRRDEKRGKRVRQVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.09
8 0.1
9 0.12
10 0.11
11 0.11
12 0.11
13 0.11
14 0.11
15 0.08
16 0.12
17 0.13
18 0.17
19 0.22
20 0.27
21 0.3
22 0.38
23 0.46
24 0.52
25 0.6
26 0.68
27 0.73
28 0.78
29 0.84
30 0.86
31 0.88
32 0.88
33 0.87
34 0.87
35 0.84
36 0.81
37 0.8
38 0.79
39 0.73
40 0.72
41 0.68
42 0.66
43 0.6
44 0.55
45 0.47
46 0.41
47 0.4
48 0.37
49 0.37
50 0.37
51 0.4
52 0.43
53 0.45
54 0.47
55 0.47
56 0.46
57 0.45
58 0.41
59 0.42
60 0.38
61 0.41
62 0.45
63 0.49
64 0.52
65 0.54
66 0.54
67 0.58
68 0.65
69 0.69
70 0.73
71 0.76
72 0.75
73 0.75
74 0.79
75 0.75
76 0.77
77 0.78
78 0.78
79 0.77
80 0.8
81 0.81
82 0.83