Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B8A3

Protein Details
Accession A0A0H1B8A3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-99ISDLILRIKKFKKKKKKKKKKNKNNSESKIQLBasic
NLS Segment(s)
PositionSequence
74-90RIKKFKKKKKKKKKKNK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKKIHSYLNSLKDKKNSQTSASAVNSAQINTVTADNNISDLIYKKNSQTSASAVNSAQINTVTADNNISDLILRIKKFKKKKKKKKKKNKNNSESKIQLAITDDFKIFQMINLTEIINISLIFVSYNSFINYRLIDSFNEHLYISKDVIFQKNFHLTDLSASFIQDLKTQLTAVYQTATVISSVISDLNFSIDNLFVEENIQLNYSLFLVLINN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.63
4 0.57
5 0.59
6 0.55
7 0.55
8 0.5
9 0.45
10 0.34
11 0.34
12 0.3
13 0.24
14 0.23
15 0.15
16 0.14
17 0.12
18 0.14
19 0.12
20 0.11
21 0.12
22 0.11
23 0.11
24 0.1
25 0.09
26 0.09
27 0.09
28 0.13
29 0.15
30 0.17
31 0.19
32 0.24
33 0.25
34 0.26
35 0.27
36 0.26
37 0.31
38 0.31
39 0.31
40 0.26
41 0.28
42 0.27
43 0.25
44 0.23
45 0.15
46 0.14
47 0.12
48 0.14
49 0.12
50 0.11
51 0.12
52 0.11
53 0.11
54 0.1
55 0.09
56 0.07
57 0.07
58 0.11
59 0.13
60 0.14
61 0.2
62 0.27
63 0.35
64 0.46
65 0.56
66 0.63
67 0.71
68 0.82
69 0.87
70 0.92
71 0.95
72 0.97
73 0.98
74 0.98
75 0.98
76 0.97
77 0.97
78 0.96
79 0.9
80 0.87
81 0.77
82 0.67
83 0.59
84 0.47
85 0.37
86 0.28
87 0.24
88 0.17
89 0.16
90 0.14
91 0.11
92 0.11
93 0.11
94 0.08
95 0.07
96 0.09
97 0.07
98 0.09
99 0.09
100 0.09
101 0.08
102 0.08
103 0.08
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.03
110 0.04
111 0.04
112 0.05
113 0.06
114 0.07
115 0.07
116 0.08
117 0.09
118 0.1
119 0.1
120 0.11
121 0.12
122 0.11
123 0.14
124 0.15
125 0.15
126 0.15
127 0.14
128 0.14
129 0.14
130 0.15
131 0.13
132 0.12
133 0.15
134 0.17
135 0.22
136 0.23
137 0.22
138 0.25
139 0.32
140 0.31
141 0.29
142 0.27
143 0.22
144 0.24
145 0.24
146 0.21
147 0.13
148 0.13
149 0.13
150 0.13
151 0.13
152 0.12
153 0.13
154 0.12
155 0.13
156 0.13
157 0.13
158 0.13
159 0.13
160 0.12
161 0.11
162 0.1
163 0.09
164 0.09
165 0.1
166 0.08
167 0.07
168 0.06
169 0.05
170 0.06
171 0.07
172 0.06
173 0.06
174 0.06
175 0.08
176 0.09
177 0.08
178 0.09
179 0.09
180 0.09
181 0.1
182 0.11
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.11
189 0.09
190 0.1
191 0.1
192 0.1
193 0.09
194 0.08