Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W8Z4

Protein Details
Accession B2W8Z4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-73KKPNTKTNTKKPEKDKTKKTQTGRVBasic
NLS Segment(s)
PositionSequence
44-94PATKVKKPNTKTNTKKPEKDKTKKTQTGRVEKVKANTKKKVAAGGKKGKKA
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MRRVQRPVSYNLTDLQRANEGLPPVPRVTTNKAGGKKSGNNQTPATKVKKPNTKTNTKKPEKDKTKKTQTGRVEKVKANTKKKVAAGGKKGKKASPTPSTSEESDYDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.27
4 0.25
5 0.24
6 0.23
7 0.2
8 0.2
9 0.21
10 0.21
11 0.19
12 0.19
13 0.2
14 0.22
15 0.27
16 0.31
17 0.36
18 0.4
19 0.45
20 0.46
21 0.47
22 0.48
23 0.47
24 0.47
25 0.5
26 0.47
27 0.45
28 0.46
29 0.46
30 0.45
31 0.45
32 0.43
33 0.4
34 0.43
35 0.47
36 0.54
37 0.55
38 0.61
39 0.62
40 0.68
41 0.7
42 0.73
43 0.76
44 0.74
45 0.78
46 0.76
47 0.79
48 0.8
49 0.81
50 0.81
51 0.8
52 0.84
53 0.85
54 0.81
55 0.8
56 0.78
57 0.79
58 0.76
59 0.75
60 0.69
61 0.64
62 0.66
63 0.67
64 0.67
65 0.64
66 0.64
67 0.6
68 0.61
69 0.6
70 0.62
71 0.61
72 0.61
73 0.63
74 0.67
75 0.69
76 0.7
77 0.72
78 0.65
79 0.64
80 0.62
81 0.61
82 0.59
83 0.57
84 0.56
85 0.58
86 0.59
87 0.54
88 0.51